PMM2/Phosphomannomutase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57753

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PMM2/Phosphomannomutase 2 Antibody - BSA Free

PMM2/Phosphomannomutase 2 Antibody

PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Western blot -Analysis using Anti-PMM2 antibody NBP2-57753 (A) shows similar pattern to independent antibody (B).

PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Western blot -Analysis using Anti-PMM2 antibody NBP2-57753 (A) shows similar pattern to independent antibody (B).
Immunocytochemistry/ Immunofluorescence: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753]

Immunocytochemistry/ Immunofluorescence: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753]

Immunocytochemistry/Immunofluorescence: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753]

Immunohistochemistry-Paraffin: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753]

Immunohistochemistry-Paraffin: PMM2/Phosphomannomutase 2 Antibody [NBP2-57753] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Applications for PMM2/Phosphomannomutase 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. IHC-P, Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PMM2/Phosphomannomutase 2

PMM2, also known as Phosphomannomutase 2, is a 246 amino acid protein that is 28 kDa, catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Studies are being performed on the relationship of this protein to congenital disorder of glycosylation, hydrops fetalis, premature ovarian failure, cerebellar hypoplasia, metabolic disorders, alcohol abuse, intellectual disability, hypertrophic cardiomyopathy, cerebellar ataxia, galactosemia, peripheral neuropathy, hypogonadism, neuropathy, hypotonia, cardiomyopathy, thrombocytopenia, ataxia, alcoholism, and malaria. The PMM2 protein has also shown an interaction with HIST1H4A, HIST1H4B, HIST1H4D, HIST1H4E, HIST1H4C, and over 130 other proteins in synthesis of substrates in N-glycan biosynthesis, asparagine N-linked glycosylation, metabolism of proteins, post-translational protein modification, biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, fructose and mannose metabolism, amino sugar and nucleotide sugar metabolism, GDP-mannose biosynthesis, and colanic acid building blocks biosynthesis pathways.

Alternate Names

CDG1, CDG1a, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2

Gene Symbol

PMM2

Additional PMM2/Phosphomannomutase 2 Products

Product Documents for PMM2/Phosphomannomutase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PMM2/Phosphomannomutase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PMM2/Phosphomannomutase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PMM2/Phosphomannomutase 2 Antibody - BSA Free and earn rewards!

Have you used PMM2/Phosphomannomutase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...