PNK Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38311

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 60-320 of human PNK (NP_009185.2).

Sequence:
RTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PNK Antibody - BSA Free

PNK Antibody

Immunohistochemistry: PNK Antibody [NBP3-38311] -

Immunohistochemistry: PNK Antibody [NBP3-38311] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using PNK Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
PNK Antibody

Western Blot: PNK Antibody [NBP3-38311] -

Western Blot: PNK Antibody [NBP3-38311] - Western blot analysis of various lysates using PNK Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
PNK Antibody

Immunocytochemistry/ Immunofluorescence: PNK Antibody [NBP3-38311] -

Immunocytochemistry/ Immunofluorescence: PNK Antibody [NBP3-38311] - Immunofluorescence analysis of GFP-RNF168 transgenic U2OS cells using PNK Rabbit pAb. Green: GFP-RNF168 fusion protein expression for DNA damage marker.Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining. RNF168(GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.
PNK Antibody

Immunohistochemistry: PNK Antibody [NBP3-38311] -

Immunohistochemistry: PNK Antibody [NBP3-38311] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using PNK Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
PNK Antibody

Immunohistochemistry: PNK Antibody [NBP3-38311] -

Immunohistochemistry: PNK Antibody [NBP3-38311] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using PNK Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for PNK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PNK

PNK catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN). Reduces laminin matrix deposition and cell adhesion to laminin, but not to fi

Long Name

Bifunctional polynucleotide phosphatase/kinase

Alternate Names

PNKP

Gene Symbol

PNKP

Additional PNK Products

Product Documents for PNK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PNK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PNK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PNK Antibody - BSA Free and earn rewards!

Have you used PNK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...