PP2C gamma/PPM1G Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87245

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PP2C gamma/PPM1G Antibody - BSA Free

Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87245]

Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87245]

Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87245] - Analysis using Anti-PPM1G antibody NBP1-87245 (A) shows similar pattern to independent antibody NBP1-87246 (B).
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining of human lymph node.
Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87245]

Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87245]

Western Blot: PP2C gamma/PPM1G Antibody [NBP1-87245] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining of human testis shows strong nuclear positivity in seminiferous tubules.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining in human testis and pancreas tissues using anti-PPM1G antibody. Corresponding PPM1G RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-PPM1G antibody NBP1-87245 (A) shows similar protein distribution across tissues to independent antibody NBP1-87246 (B).
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining of human kidney.
Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunohistochemistry-Paraffin: PP2C gamma/PPM1G Antibody [NBP1-87245] - Staining of human cerebral cortex.
PP2C gamma/PPM1G Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: PP2C gamma/PPM1G Antibody [NBP1-87245]

Immunocytochemistry/ Immunofluorescence: PP2C gamma/PPM1G Antibody [NBP1-87245]

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Applications for PP2C gamma/PPM1G Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PP2C gamma

PPM1G is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. Alternatively spliced transcript variants encoding the same protein have been described.

Long Name

Protein Phosphatase 2C gamma

Alternate Names

PP2CG, PPM1C, PPM1G, PPP2CG

Gene Symbol

PPM1G

Additional PP2C gamma Products

Product Documents for PP2C gamma/PPM1G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PP2C gamma/PPM1G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PP2C gamma/PPM1G Antibody - BSA Free

Customer Reviews for PP2C gamma/PPM1G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PP2C gamma/PPM1G Antibody - BSA Free and earn rewards!

Have you used PP2C gamma/PPM1G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...