PRPF8 Antibody (4I1Q8)

Novus Biologicals | Catalog # NBP3-16440

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4I1Q8 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 2200-2335 of human PRPF8 (Q6P2Q9). MADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

274 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PRPF8 Antibody (4I1Q8)

Western Blot: PRPF8 Antibody (4I1Q8) [NBP3-16440]

Western Blot: PRPF8 Antibody (4I1Q8) [NBP3-16440]

Western Blot: PRPF8 Antibody (4I1Q8) [NBP3-16440] - Western blot analysis of extracts of various cell lines, using PRPF8 Rabbit mAb (NBP3-16440) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: PRPF8 Antibody (4I1Q8) [NBP3-16440]

Immunocytochemistry/ Immunofluorescence: PRPF8 Antibody (4I1Q8) [NBP3-16440]

Immunocytochemistry/Immunofluorescence: PRPF8 Antibody (4I1Q8) [NBP3-16440] - Immunofluorescence analysis of U-2 OS cells using PRPF8 Rabbit mAb (NBP3-16440) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
PRPF8 Antibody (4I1Q8)

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] -

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] - Immunohistochemistry analysis of PRPF8 in paraffin-embedded mouse brain tissue using PRPF8 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PRPF8 Antibody (4I1Q8)

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] -

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] - Immunohistochemistry analysis of PRPF8 in paraffin-embedded human colon carcinoma tissue using PRPF8 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PRPF8 Antibody (4I1Q8)

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] -

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] - Immunohistochemistry analysis of PRPF8 in paraffin-embedded human cervix cancer tissue using PRPF8 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PRPF8 Antibody (4I1Q8)

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] -

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] - Immunohistochemistry analysis of PRPF8 in paraffin-embedded rat colon tissue using PRPF8 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
PRPF8 Antibody (4I1Q8)

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] -

Immunohistochemistry: PRPF8 Antibody (4I1Q8) [NBP3-16440] - Immunohistochemistry analysis of PRPF8 in paraffin-embedded mouse colon tissue using PRPF8 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for PRPF8 Antibody (4I1Q8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PRPF8

Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. This gene is a candidate gene for autosomal dominant retinitis pigmentosa. [provided by RefSeq]

Alternate Names

apoptosis-regulated protein 1, apoptosis-regulated protein 2, p220, precursor mRNA processing protein, pre-mRNA-processing-splicing factor 8, Prp8, PRP8 homolog, PRP8 pre-mRNA processing factor 8 homolog (S. cerevisiae), PRP8 pre-mRNA processing factor 8 homolog (yeast), PRP8,220 kDa U5 snRNP-specific protein, PRPC8HPRP8, RP13, Splicing factor Prp8, U5 snRNP-specific protein (220 kD), ortholog of S. cerevisiae Prp8p

Gene Symbol

PRPF8

Additional PRPF8 Products

Product Documents for PRPF8 Antibody (4I1Q8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PRPF8 Antibody (4I1Q8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRPF8 Antibody (4I1Q8)

There are currently no reviews for this product. Be the first to review PRPF8 Antibody (4I1Q8) and earn rewards!

Have you used PRPF8 Antibody (4I1Q8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...