PTF1A Antibody (1A2) - Azide and BSA Free

Novus Biologicals | Catalog # H00256297-M05

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2A Clone # 1A2

Format

Azide and BSA Free
View all PTF1A Primary Antibodies »

Product Specifications

Immunogen

PTF1A (NP_835455, 250 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

Specificity

PTF1A (1A2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2A

Scientific Data Images for PTF1A Antibody (1A2) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PTF1A Antibody (1A2) [H00256297-M05]

Immunocytochemistry/ Immunofluorescence: PTF1A Antibody (1A2) [H00256297-M05]

Immunocytochemistry/Immunofluorescence: PTF1A Antibody (1A2) [H00256297-M05] - Analysis of monoclonal antibody to PTF1A on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: PTF1A Antibody (1A2) [H00256297-M05]

Immunohistochemistry-Paraffin: PTF1A Antibody (1A2) [H00256297-M05]

Immunohistochemistry-Paraffin: PTF1A Antibody (1A2) [H00256297-M05] - Analysis of monoclonal antibody to PTF1A on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml
ELISA: PTF1A Antibody (1A2) [H00256297-M05]

ELISA: PTF1A Antibody (1A2) [H00256297-M05]

ELISA: PTF1A Antibody (1A2) [H00256297-M05] - Detection limit for recombinant GST tagged PTF1A is approximately 0.03ng/ml as a capture antibody.

Applications for PTF1A Antibody (1A2) - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

10 ug/ml

Western Blot

1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: PTF1A

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers.

Long Name

Pancreas-specific Transcription Factor 1a

Alternate Names

PTF1-p48

Entrez Gene IDs

256297 (Human)

Gene Symbol

PTF1A

OMIM

607194 (Human)

UniProt

NP_835455 (Human)

Additional PTF1A Products

Product Documents for PTF1A Antibody (1A2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTF1A Antibody (1A2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTF1A Antibody (1A2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PTF1A Antibody (1A2) - Azide and BSA Free and earn rewards!

Have you used PTF1A Antibody (1A2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies