Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38327
![Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Western-Blot-NBP2-38327-img0009.jpg "Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Predicted:
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38327-img0004.jpg "Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
Immunocytochemistry/ Immunofluorescence: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]
Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.![Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/nbp2-38327_-immunohistochemistry-paraffin-639173121425672957.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
![Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/nbp2-38327_-immunohistochemistry-paraffin-639173124772815527.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]
Staining of human kidney shows strong granular cytoplasmic positivity in cells in distal tubules.![Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/nbp2-38327_-immunohistochemistry-paraffin-639173125110790432.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]
Staining of human pancreas shows weak to moderate granular cytoplasmic positivity in exocrine glandular cells.![Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/nbp2-38327_-immunohistochemistry-paraffin-639173132459378443.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]
Staining of human cerebral cortex shows moderate positivity in neuropil.![Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/nbp2-38327_-immunohistochemistry-paraffin-639173132798028249.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]
Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.![Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]](https://resources.rndsystems.com/images/products/nbp2-38327_-immunohistochemistry-paraffin-639173302814507674.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327]")
Applications for Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Pyruvate Dehydrogenase E1 beta subunit
Alternate Names
DKFZp564K0164, mitochondrial, pyruvate dehydrogenase (lipoamide) beta, pyruvate dehydrogenase, E1 beta polypeptide
Gene Symbol
PDHB
UniProt
Additional Pyruvate Dehydrogenase E1 beta subunit Products
Product Documents for Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free and earn rewards!
Have you used Pyruvate Dehydrogenase E1 beta subunit Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...