RAB42 Antibody (3A2) - Azide and BSA Free
Novus Biologicals | Catalog # H00115273-M03
![Immunocytochemistry/ Immunofluorescence: RAB42 Antibody (3A2) [H00115273-M03]](https://resources.rndsystems.com/images/products/RAB42-Antibody-3A2-Immunocytochemistry-Immunofluorescence-H00115273-M03-img0002.jpg "Immunocytochemistry/ Immunofluorescence: RAB42 Antibody (3A2) [H00115273-M03]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 3A2
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
RAB42 (NP_689517, 46 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC
Reactivity Notes
Human. Other species not tested.
Specificity
RAB42 - RAB42, member RAS homolog family
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Scientific Data Images for RAB42 Antibody (3A2) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence: RAB42 Antibody (3A2) [H00115273-M03]
Immunocytochemistry/Immunofluorescence: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on HeLa cell. Antibody concentration 10 ug/ml![Immunohistochemistry-Paraffin: RAB42 Antibody (3A2) [H00115273-M03]](https://resources.rndsystems.com/images/products/RAB42-Antibody-3A2-Immunohistochemistry-Paraffin-H00115273-M03-img0003.jpg "Immunohistochemistry-Paraffin: RAB42 Antibody (3A2) [H00115273-M03]")
Immunohistochemistry-Paraffin: RAB42 Antibody (3A2) [H00115273-M03]
Immunohistochemistry-Paraffin: RAB42 Antibody (3A2) [H00115273-M03] - Analysis of monoclonal antibody to RAB42 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml
Western Blot: RAB42 Antibody (3A2) - Azide and BSA Free [H00115273-M03] -
The RAB42 expression levels in local GBM cells and specmens. (A,B) RAB42 mRNA expression and protein expression were both upregulated in GBM cell lines, respectively (vs. HA1800; * p <0.05, ** p < 0.01, *** p < 0.001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35741652), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RAB42 Antibody (3A2) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Reviewed Applications
Read 1 review rated 4 using H00115273-M03 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: RAB42
Alternate Names
MGC45806, putative Ras-related protein Rab-42, RAB42, member RAS homolog family, RAB42, member RAS oncogene family, RP4-669K10.6
Entrez Gene IDs
115273 (Human)
Gene Symbol
RAB42
UniProt
Additional RAB42 Products
Product Documents for RAB42 Antibody (3A2) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RAB42 Antibody (3A2) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RAB42 Antibody (3A2) - Azide and BSA Free
Powered by Bioz
Customer Reviews for RAB42 Antibody (3A2) - Azide and BSA Free (1)
4 out of 5
1 Customer Rating
Have you used RAB42 Antibody (3A2) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: Human cancer cellSpecies: HumanVerified Customer | Posted 09/08/2015
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...