RAD18 Antibody (3H7) - Azide and BSA Free
Novus Biologicals | Catalog # H00056852-M01
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Knockdown Validated
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 3H7
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 26549024). Other species have not been tested.
Specificity
RAD18 - RAD18 homolog (S. cerevisiae)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Scientific Data Images for RAD18 Antibody (3H7) - Azide and BSA Free
Western Blot: RAD18 Antibody (3H7) [H00056852-M01]
Western Blot: RAD18 Antibody (3H7) [H00056852-M01] - Analysis of RAD18 expression in transfected 293T cell line by RAD18 monoclonal antibody (M01), clone 3H7.Lane 1: RAD18 transfected lysate(56.2 KDa).Lane 2: Non-transfected lysate.Immunocytochemistry/ Immunofluorescence: RAD18 Antibody (3H7) [H00056852-M01]
Immunocytochemistry/Immunofluorescence: RAD18 Antibody (3H7) [H00056852-M01] - The antibody was used to detect RAD18 in U2os Cells. Anti-mouse 2nd antibody was used for detection (Red). DAPI was used for nuclear staining (Blue). This image was submitted via customer Review.Immunohistochemistry-Paraffin: RAD18 Antibody (3H7) [H00056852-M01]
Immunohistochemistry-Paraffin: RAD18 Antibody (3H7) [H00056852-M01] - Analysis of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml.Western Blot: RAD18 Antibody (3H7) [H00056852-M01]
Western Blot: RAD18 Antibody (3H7) [H00056852-M01] - Analysis of RAD18 over-expressed 293 cell line, cotransfected with RAD18 Validated Chimera RNAi ( Cat # H00056852-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD18 monoclonal antibody (M01), clone 3H7 (Cat # H00056852-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Western Blot: RAD18 Antibody (3H7) [H00056852-M01]
Western Blot: RAD18 Antibody (3H7) [H00056852-M01] - RAD18 monoclonal antibody (M01), clone 3H7. Analysis of RAD18 expression in PC-12.Western Blot: RAD18 Antibody (3H7) [H00056852-M01]
Western Blot: RAD18 Antibody (3H7) [H00056852-M01] - RAD18 monoclonal antibody (M01), clone 3H7 Analysis of RAD18 expression in Hela S3 NE.Immunocytochemistry/ Immunofluorescence: RAD18 Antibody (3H7) [H00056852-M01]
Immunocytochemistry/Immunofluorescence: RAD18 Antibody (3H7) [H00056852-M01] - Analysis of monoclonal antibody to RAD18 on HeLa cell. Antibody concentration 25 ug/ml.ELISA: RAD18 Antibody (3H7) [H00056852-M01]
ELISA: RAD18 Antibody (3H7) [H00056852-M01] - Detection limit for recombinant GST tagged RAD18 is approximately 0.1ng/ml as a capture antibody.Applications for RAD18 Antibody (3H7) - Azide and BSA Free
Application
Recommended Usage
ELISA
1:100-1:2000
Immunocytochemistry/ Immunofluorescence
25 ug/ml
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1.5 ug/ml
Western Blot
1:500
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluorescence, immunohistochemistry (paraffin), RNAi validation and ELISA.
Reviewed Applications
Read 2 reviews rated 3.5 using H00056852-M01 in the following applications:
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: RAD18
Alternate Names
EC 6.3.2.-, hHR18, hRAD18, postreplication repair protein hRAD18p, Postreplication repair protein RAD18, RAD18 homolog (S. cerevisiae), RAD18, S. cerevisiae, homolog, RING finger protein 73, RNF73E3 ubiquitin-protein ligase RAD18
Entrez Gene IDs
56852 (Human)
Gene Symbol
RAD18
OMIM
605256 (Human)
UniProt
Additional RAD18 Products
Product Documents for RAD18 Antibody (3H7) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RAD18 Antibody (3H7) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RAD18 Antibody (3H7) - Azide and BSA Free
Customer Reviews for RAD18 Antibody (3H7) - Azide and BSA Free (2)
3.5 out of 5
2 Customer Ratings
Have you used RAD18 Antibody (3H7) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: ImmunofluorescenceSample Tested: Human cellsSpecies: HumanVerified Customer | Posted 09/12/2017The antibody was used to detect RAD18 in U2os Cells. Anti-mouse 2nd antibody was used for detection (Red). DAPI was used for nuclear staining (Blue).
-
Application: Western BlotSample Tested: Human cell culture, Sample Amount: 50ugSpecies: HumanVerified Customer | Posted 07/06/2009
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...