RCC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38248

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human RCC1 (NP_001260.1).

Sequence:
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RCC1 Antibody - BSA Free

RCC1 Antibody

Western Blot: RCC1 Antibody [NBP3-38248] -

Western Blot: RCC1 Antibody [NBP3-38248] - Western blot analysis of various lysates using RCC1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
RCC1 Antibody

Immunohistochemistry: RCC1 Antibody [NBP3-38248] -

Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RCC1 Antibody

Immunocytochemistry/ Immunofluorescence: RCC1 Antibody [NBP3-38248] -

Immunocytochemistry/ Immunofluorescence: RCC1 Antibody [NBP3-38248] - Immunofluorescence analysis of HeLa cells using RCC1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RCC1 Antibody

Immunohistochemistry: RCC1 Antibody [NBP3-38248] -

Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Rat lung using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RCC1 Antibody

Immunohistochemistry: RCC1 Antibody [NBP3-38248] -

Immunohistochemistry: RCC1 Antibody [NBP3-38248] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using RCC1 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for RCC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RCC1

Promotes the exchange of Ran-bound GDP by GTP. Involved in the regulation of onset of chromosome condensationin the S phase. Binds to the chromatin. RCC1/Ran complex (together with other proteins) acts as a component of asignal transmission pathway that detects unreplicated DNA

Alternate Names

Cell cycle regulatory protein, CHC1RCC1-I, chromosome condensation 1, Chromosome condensation protein 1, guanine nucleotide-releasing protein, regulator of chromosome condensation, regulator of chromosome condensation 1, SNHG3-RCC1, SNHG3-RCC1 readthrough transcript

Gene Symbol

RCC1

Additional RCC1 Products

Product Documents for RCC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RCC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RCC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RCC1 Antibody - BSA Free and earn rewards!

Have you used RCC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...