RCN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83483

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RCN1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RCN1 Antibody - BSA Free

Western Blot: RCN1 Antibody [NBP1-83483]

Western Blot: RCN1 Antibody [NBP1-83483]

Western Blot: RCN1 Antibody [NBP1-83483] - Analysis using Anti-RCN1 antibody NBP1-83483 (A) shows similar pattern to independent antibody NBP2-37987 (B).
Immunocytochemistry/ Immunofluorescence: RCN1 Antibody [NBP1-83483]

Immunocytochemistry/ Immunofluorescence: RCN1 Antibody [NBP1-83483]

Immunocytochemistry/Immunofluorescence: RCN1 Antibody [NBP1-83483] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human pancreas shows very weak cytoplasmic positivity in intercalated ducts and Islets of Langerhans.
Western Blot: RCN1 Antibody [NBP1-83483]

Western Blot: RCN1 Antibody [NBP1-83483]

Western Blot: RCN1 Antibody [NBP1-83483] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human small intestine shows moderate cytoplasmic positivity in Paneth cells
Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483]

Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Applications for RCN1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RCN1

Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs, in comparison to mouse reticulocalbin, is consistent with a possible biochemical function besides that of calcium binding.

Alternate Names

FLJ37041, FLJ55835, PIG20, proliferation-inducing gene 20, Rcal, RCN, reticulocalbin 1, EF-hand calcium binding domain, reticulocalbin-1

Gene Symbol

RCN1

Additional RCN1 Products

Product Documents for RCN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RCN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RCN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RCN1 Antibody - BSA Free and earn rewards!

Have you used RCN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies