ROR alpha/NR1F1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-52813

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ROR alpha/NR1F1 Antibody - BSA Free

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

ROR-alpha-NR1F1-Antibody-Western-Blot-NBP1-52813-img0004.jpg
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentration 1.25ug/ml.
ROR alpha/NR1F1 Antibody

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] -

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - BMAL1 controls HIF-1 activity without affecting HIF-alpha -TAD functionA. Evaluation of BMAL1 & ROR alpha expression by Western blot in NP cells stably transduced with lentivirus expressing BMAL1 shRNA. B., C. Densitometric analysis of multiple blots shown in (A) demonstrated decreased BMAL1 (B) & ROR alpha (C) expression in BMAL1-silenced cells under both normoxia & hypoxia. D. HRE activity of BMAL1-silenced NP cells is significantly lower than cells transduced with control shRNA. E.-G. Evaluation of BMAL1 control of HIF-alpha -TAD function. BMAL1 overexpression had no effects on HIF-1 alpha -C-TAD (E), HIF-1 alpha -N-TAD (F), as well as HIF-2 alpha -TAD (G) regardless of oxygen tension. Data is represented as mean ± SE, n= 3, * p<0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27049729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ROR alpha/NR1F1 Antibody

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] -

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - BMAL1 & ROR alpha do not bind to HIF-1 alpha in NP cellsA. Immunoprecipitation (IP) of BMAL1 & CLOCK from NP cells cultured under normoxia or hypoxia for 24 h followed by Western blot analysis using anti-HIF-1 alpha, anti-BMAL1 & anti-CLOCK antibodies. BMAL1 bound to CLOCK, but neither BMAL1 nor CLOCK bound to HIF-1 alpha irrespective of oxygen tension. Preimmune rabbit IgG was used as a negative control for IP assays. B. Pulldown of HIF-1 alpha did not show co-precipitation of BMAL1, CLOCK, or ROR alpha. HC: heavy chain of IgG, nsp: non-specific (C) Pulldown of HIF-1 alpha showed co- precipitation of HIF-1 beta /ARNT, association was higher under hypoxia. D., E. Treatment of NP cells with ROR alpha inhibitor, ML-176 (10 μM), showed no effect on nuclear levels of HIF-1 alpha. Densitometric analysis shown in (E) was performed on blots from 3 independent experiments, Data is represented as mean ± SE, * p < 0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27049729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ROR alpha/NR1F1 Antibody

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] -

Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - Expression analysis of BMAL1 & other related factors in NP cellsA. Immunohistochemical localization of BMAL1 in rat intervertebral disc. Sagittal sections of the mature rat intervertebral disc, immunostained with BMAL1 antibody, showed prominent nuclear expression in NP tissue. B. Western blot analysis of BMAL1 & ROR alpha expression in NP tissues isolated from three rats showed positive expression for both the proteins. C. qRT-PCR analysis of BMAL-1 & ROR alpha mRNA expression from NP & AF tissues from rat discs (n=3 animals/group) D. qRT-PCR analysis of BMAL1, ROR alpha, ARNT, ARNT2, ARNTL2 & CLOCK expression in rat NP cells cultured under hypoxia (1% O2). None of the genes showed significant increase in hypoxia. E. Western blot analysis of BMAL1 & ROR alpha in NP cells cultured under hypoxia. F., G. Densitometric analysis of multiple blots shown in (E) above. No significant differences were seen between normoxic & hypoxic levels of BMAL1 & ROR alpha. Data is represented as mean ± SE, n=3, p<0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27049729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
ROR alpha/NR1F1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ROR alpha/NR1F1 Antibody - BSA Free [NBP1-52813] -

Derp1 markedly downregulated ROR alpha in HNEpC cells. Epithelial cells (HNEpC) were cultured and treated with 0, 5, 10, and 15 μg/mL Derp1 to construct an in vitro model. (A) RT‐qPCR results showed the changes in ROR alpha expression. (B) Western blot assays were performed to evaluate changes in ROR alpha protein expression. (C) The expression and location of IL‐33 in HNEpC cells were evaluated by IF assays. Magnification, ×400; scale bar = 10 μm. *p <.05; **p <.01. IF, immunofluorescence; ROR alpha, receptor related orphan receptor alpha. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37904695), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for ROR alpha/NR1F1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1.0 ug/ml
Application Notes
Use in Immunofluorescence (PMID: 21480365), IHC-P reported in scientific literature (PMID:35803929).

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ROR alpha/NR1F1

The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Four transcript variants encoding different isoforms have been described for this gene.

Long Name

Retinoic Acid-Related Orphan Receptor alpha

Alternate Names

NR1F1, RORA, RZRA

Entrez Gene IDs

6095 (Human)

Gene Symbol

RORA

UniProt

Additional ROR alpha/NR1F1 Products

Product Documents for ROR alpha/NR1F1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ROR alpha/NR1F1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ROR alpha/NR1F1 Antibody - BSA Free

Customer Reviews for ROR alpha/NR1F1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ROR alpha/NR1F1 Antibody - BSA Free and earn rewards!

Have you used ROR alpha/NR1F1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...