ROR alpha/NR1F1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-52813
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Rat
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to RORA (RAR-related orphan receptor A) The peptide sequence was selected from the N terminal of RORA (P35398-3). Peptide sequence CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for ROR alpha/NR1F1 Antibody - BSA Free
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]
ROR-alpha-NR1F1-Antibody-Western-Blot-NBP1-52813-img0004.jpgWestern Blot: ROR alpha/NR1F1 Antibody [NBP1-52813]
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - HepG2 cell lysate, concentration 1.25ug/ml.Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] -
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - BMAL1 controls HIF-1 activity without affecting HIF-alpha -TAD functionA. Evaluation of BMAL1 & ROR alpha expression by Western blot in NP cells stably transduced with lentivirus expressing BMAL1 shRNA. B., C. Densitometric analysis of multiple blots shown in (A) demonstrated decreased BMAL1 (B) & ROR alpha (C) expression in BMAL1-silenced cells under both normoxia & hypoxia. D. HRE activity of BMAL1-silenced NP cells is significantly lower than cells transduced with control shRNA. E.-G. Evaluation of BMAL1 control of HIF-alpha -TAD function. BMAL1 overexpression had no effects on HIF-1 alpha -C-TAD (E), HIF-1 alpha -N-TAD (F), as well as HIF-2 alpha -TAD (G) regardless of oxygen tension. Data is represented as mean ± SE, n= 3, * p<0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27049729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] -
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - BMAL1 & ROR alpha do not bind to HIF-1 alpha in NP cellsA. Immunoprecipitation (IP) of BMAL1 & CLOCK from NP cells cultured under normoxia or hypoxia for 24 h followed by Western blot analysis using anti-HIF-1 alpha, anti-BMAL1 & anti-CLOCK antibodies. BMAL1 bound to CLOCK, but neither BMAL1 nor CLOCK bound to HIF-1 alpha irrespective of oxygen tension. Preimmune rabbit IgG was used as a negative control for IP assays. B. Pulldown of HIF-1 alpha did not show co-precipitation of BMAL1, CLOCK, or ROR alpha. HC: heavy chain of IgG, nsp: non-specific (C) Pulldown of HIF-1 alpha showed co- precipitation of HIF-1 beta /ARNT, association was higher under hypoxia. D., E. Treatment of NP cells with ROR alpha inhibitor, ML-176 (10 μM), showed no effect on nuclear levels of HIF-1 alpha. Densitometric analysis shown in (E) was performed on blots from 3 independent experiments, Data is represented as mean ± SE, * p < 0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27049729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] -
Western Blot: ROR alpha/NR1F1 Antibody [NBP1-52813] - Expression analysis of BMAL1 & other related factors in NP cellsA. Immunohistochemical localization of BMAL1 in rat intervertebral disc. Sagittal sections of the mature rat intervertebral disc, immunostained with BMAL1 antibody, showed prominent nuclear expression in NP tissue. B. Western blot analysis of BMAL1 & ROR alpha expression in NP tissues isolated from three rats showed positive expression for both the proteins. C. qRT-PCR analysis of BMAL-1 & ROR alpha mRNA expression from NP & AF tissues from rat discs (n=3 animals/group) D. qRT-PCR analysis of BMAL1, ROR alpha, ARNT, ARNT2, ARNTL2 & CLOCK expression in rat NP cells cultured under hypoxia (1% O2). None of the genes showed significant increase in hypoxia. E. Western blot analysis of BMAL1 & ROR alpha in NP cells cultured under hypoxia. F., G. Densitometric analysis of multiple blots shown in (E) above. No significant differences were seen between normoxic & hypoxic levels of BMAL1 & ROR alpha. Data is represented as mean ± SE, n=3, p<0.05. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27049729), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: ROR alpha/NR1F1 Antibody - BSA Free [NBP1-52813] -
Derp1 markedly downregulated ROR alpha in HNEpC cells. Epithelial cells (HNEpC) were cultured and treated with 0, 5, 10, and 15 μg/mL Derp1 to construct an in vitro model. (A) RT‐qPCR results showed the changes in ROR alpha expression. (B) Western blot assays were performed to evaluate changes in ROR alpha protein expression. (C) The expression and location of IL‐33 in HNEpC cells were evaluated by IF assays. Magnification, ×400; scale bar = 10 μm. *p <.05; **p <.01. IF, immunofluorescence; ROR alpha, receptor related orphan receptor alpha. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37904695), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for ROR alpha/NR1F1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:10-1:2000
Western Blot
1.0 ug/ml
Application Notes
Use in Immunofluorescence (PMID: 21480365), IHC-P reported in scientific literature (PMID:35803929).
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ROR alpha/NR1F1
Long Name
Retinoic Acid-Related Orphan Receptor alpha
Alternate Names
NR1F1, RORA, RZRA
Entrez Gene IDs
6095 (Human)
Gene Symbol
RORA
UniProt
Additional ROR alpha/NR1F1 Products
Product Documents for ROR alpha/NR1F1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ROR alpha/NR1F1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for ROR alpha/NR1F1 Antibody - BSA Free
Customer Reviews for ROR alpha/NR1F1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ROR alpha/NR1F1 Antibody - BSA Free and earn rewards!
Have you used ROR alpha/NR1F1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...