RPL24/RLP24 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38971

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPL24/RLP24 Antibody - BSA Free

Western Blot: RPL24/RLP24 Antibody [NBP2-38971]

Western Blot: RPL24/RLP24 Antibody [NBP2-38971]

Western Blot: RPL24/RLP24 Antibody [NBP2-38971] - Analysis using Anti-RSL24D1 antibody NBP2-38971 (A) shows similar pattern to independent antibody NBP2-38992 (B).
Immunocytochemistry/ Immunofluorescence: RPL24/RLP24 Antibody [NBP2-38971]

Immunocytochemistry/ Immunofluorescence: RPL24/RLP24 Antibody [NBP2-38971]

Immunocytochemistry/Immunofluorescence: RPL24/RLP24 Antibody [NBP2-38971] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human colon, kidney, liver and testis using Anti-RSL24D1 antibody NBP2-38971 (A) shows similar protein distribution across tissues to independent antibody NBP2-38992 (B).
Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human colon shows strong positivity in nucleoli in glandular cells.
Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human kidney shows strong positivity in nucleoli in cells in tubules.
Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human liver shows strong positivity in nucleoli in hepatocytes.
Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971]

Immunohistochemistry-Paraffin: RPL24/RLP24 Antibody [NBP2-38971] - Staining of human testis shows strong positivity in nucleoli in cells in seminiferous ducts and in Leydig cells.

Applications for RPL24/RLP24 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPL24/RLP24

RPL24/RLP24 encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although RPL24/RLP24 has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]

Alternate Names

C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, RSL24D1 ribosomal L24 domain containing 1, TVAS3

Gene Symbol

RSL24D1

UniProt

Additional RPL24/RLP24 Products

Product Documents for RPL24/RLP24 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPL24/RLP24 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPL24/RLP24 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPL24/RLP24 Antibody - BSA Free and earn rewards!

Have you used RPL24/RLP24 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...