RRM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38129

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-389 of human RRM2 (NP_001025.1).

Sequence:
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RRM2 Antibody - BSA Free

RRM2 Antibody

Immunoprecipitation: RRM2 Antibody [NBP3-38129] -

Immunoprecipitation: RRM2 Antibody [NBP3-38129] - Immunoprecipitation analysis of 200 ug extracts of HeLa cells using RRM2 antibody. Western blot was performed from the immunoprecipitate using RRM2 antibody at a dilution of 1:1000.
RRM2 Antibody

Immunohistochemistry: RRM2 Antibody [NBP3-38129] -

Immunohistochemistry: RRM2 Antibody [NBP3-38129] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using RRM2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
RRM2 Antibody

Immunocytochemistry/ Immunofluorescence: RRM2 Antibody [NBP3-38129] -

Immunocytochemistry/ Immunofluorescence: RRM2 Antibody [NBP3-38129] - Immunofluorescence analysis of U2OS cells using RRM2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RRM2 Antibody

Western Blot: RRM2 Antibody [NBP3-38129] -

Western Blot: RRM2 Antibody [NBP3-38129] - Western blot analysis of lysates from HeLa cells, using RRM2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
RRM2 Antibody

Immunohistochemistry: RRM2 Antibody [NBP3-38129] -

Immunohistochemistry: RRM2 Antibody [NBP3-38129] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using RRM2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for RRM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RRM2

Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Long Name

Ribonucleotide Reductase Regulatory Subunit M2

Alternate Names

C2orf48, FLJ25102, RR2M

Gene Symbol

RRM2

Additional RRM2 Products

Product Documents for RRM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RRM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RRM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RRM2 Antibody - BSA Free and earn rewards!

Have you used RRM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...