RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

Novus Biologicals | Catalog # H00000860-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2B Clone # 1D8

Format

Azide and BSA Free
View all RUNX2/CBFA1 Primary Antibodies »

Product Specifications

Immunogen

RUNX2/CBFA1 (NP_004339, 251 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2B

Theoretical MW

56.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Analysis of RUNX2 expression in transfected 293T cell line by RUNX2 monoclonal antibody (M01), clone 1D8.Lane 1: RUNX2 transfected lysate (Predicted MW: 60.28 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Analysis of monoclonal antibody to RUNX2 on U-2 OS cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Analysis of monoclonal antibody to RUNX2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Western Blot analysis of RUNX2 expression in SJCRH30 ( Cat # L027V1 ).
Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Western Blot analysis of RUNX2 expression in K-562 ( Cat # L009V1 ).
Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01]

Western Blot: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - RUNX2 monoclonal antibody (M01), clone 1D8. Analysis of RUNX2 expression in Jurkat.
Sandwich ELISA: RUNX2/CBFA1 Antibody (1D8) [H00000860-M01] - Detection limit for recombinant GST tagged RUNX2 is approximately 0.03ng/ml as a capture antibody.

Applications for RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: RUNX2/CBFA1

Runt-related transcription factor 2 (RUNX2), also known as CBFA1, AML-3, PEBP-2alphaA, and OSF-2, is a transcription factor that places a critical role in osteoblast differentiation and bone development (1-3). RUNX2 is a DNA-binding protein that belongs to the RUNX family which share a common runt domain (3). RUNX2 has two main isoforms which vary based on the two promoter regions (3). The main canonical isoform (P1) has MASN/DS at its N-terminus while the other (P2) isoform includes a MRIPV pentapeptide at its N-terminus (3). The RUNX2 P1 isoform has a theoretical molecular weight of 56 kDa and is synthesized as a 521 amino acid (aa) protein containing multiple domains. Specifically, RUNX2 contains transactivation domains (AD1, 2 and 3), a glutamine/alanine (Q/A)-rich domain, a runt homology domain (RHD), a nuclear localization signal (NLS), a proline/serine/threonine (PST)-rich domain, a nuclear matrix targeting signal (NMTS), a repression domain (RD), and a VWRPY region (3). RUNX2 is a heterodimer of an alpha and beta subunit where the alpha subunit binds DNA through the runt domain and the binding affinity is increased through heterodimerization (4).

Functionally, RUNX2 promotes the expression of osteoblast-specific genes vital for the osteoblast differentiation and proliferation process including type I collagen, osteocalcin (OCN), and alkaline phosphatase (APC) (1, 3). Further evidence for the role of RUNX2 is highlighted by a study of Runx2-/-mice which completely lack osteoblasts (4). Additionally, RUNX2 is also required for chondrocyte maturation, which are the cells responsible for cartilage formation (1, 3, 5). Given the role of RUNX2 in bone and cartilage maturation and formation, it is clear that defects or mutations in RUNX2 cause various bone and bone-related diseases (3, 6, 7). For instance, cleidocranial dysplasia (CCD), which presents with delayed cranial suture closure phenotypes, hypoplastic clavicles, extra teeth, and short stature, is caused by haploinsufficiency in RUNX2 (2, 3, 6). Furthermore, metaphyseal dysplasia with maxillary hypoplasia and brachydactyly (MDMHB) is a bone dysplasia disorder with a phenotype of abnormalities in the long bones, an underdeveloped jawbone, and short fingers that is caused by a duplication in RUNX2 (6). Finally, RUNX2 has been shown to be upregulated in mouse models of the joint disorder osteoarthritis (OA) and may be a potential molecular target for disease treatment (7).

Alternative names for RUNX2 include Acute myeloid leukemia 3 protein CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, MGC120023, ML3, oncogene AML-3, OSF2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt related transcription factor 2, SL3/AKV core-binding factor alpha A subunit, and SL3-3 enhancer factor 1 alpha A subunit.

References

1. Ferreira, L. B., Gimba, E., Vinagre, J., Sobrinho-Simoes, M., & Soares, P. (2020). Molecular Aspects of Thyroid Calcification. International journal of molecular sciences. https://doi.org/10.3390/ijms21207718

2. Kim, W. J., Shin, H. L., Kim, B. S., Kim, H. J., & Ryoo, H. M. (2020). RUNX2-modifying enzymes: therapeutic targets for bone diseases. Experimental & molecular medicine. https://doi.org/10.1038/s12276-020-0471-4

3. Vimalraj, S., Arumugam, B., Miranda, P. J., & Selvamurugan, N. (2015). Runx2: Structure, function, and phosphorylation in osteoblast differentiation. International journal of biological macromolecules. https://doi.org/10.1016/j.ijbiomac.2015.04.008

4. Uniprot (Q13950)

5. Komori T. (2017). Roles of Runx2 in Skeletal Development. Advances in experimental medicine and biology. https://doi.org/10.1007/978-981-10-3233-2_6

6. Moffatt, P., Ben Amor, M., Glorieux, F. H., Roschger, P., Klaushofer, K., Schwartzentruber, J. A., Paterson, A. D., Hu, P., Marshall, C., FORGE Canada Consortium, Fahiminiya, S., Majewski, J., Beaulieu, C. L., Boycott, K. M., & Rauch, F. (2013). Metaphyseal dysplasia with maxillary hypoplasia and brachydactyly is caused by a duplication in RUNX2. American journal of human genetics. https://doi.org/10.1016/j.ajhg.2012.12.001

7. Chen, D., Kim, D. J., Shen, J., Zou, Z., & O'Keefe, R. J. (2019). Runx2 plays a central role in Osteoarthritis development. Journal of orthopaedic translation. https://doi.org/10.1016/j.jot.2019.11.008

Long Name

Runt-related Transcription Factor 2

Alternate Names

CBFA1

Entrez Gene IDs

860 (Human)

Gene Symbol

RUNX2

OMIM

119600 (Human)

UniProt

NP_004339 (Human)

Additional RUNX2/CBFA1 Products

Product Documents for RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

Customer Reviews for RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free and earn rewards!

Have you used RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RUNX2/CBFA1 Antibody (1D8) - Azide and BSA Free

Showing  1 - 1 of 1 FAQ Showing All

    • Q: We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.
      A: We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.
Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies