RUNX2/CBFA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89104

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunohistochemistry-Frozen, Western Blot, Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This RUNX2/CBFA1 Antibody was developed against Recombinant Protein corresponding to amino acids: LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA

Reactivity Notes

Expected reactivity in Rat (81%). Mouse reactivity reported in scientific literature (PMID: 26489514).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit RUNX2/CBFA1 Antibody - BSA Free (NBP1-89104) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-RUNX2/CBFA1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RUNX2/CBFA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining in human tonsil and liver tissues. Corresponding RUNX2 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunocytochemistry/ Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunocytochemistry/Immunofluorescence: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human tonsil shows moderate to strong nuclear positivity in a subset lymphoid cells.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human rectum shows moderate to strong nuclear positivity in lymphoid cells.
Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104]

Immunohistochemistry-Paraffin: RUNX2/CBFA1 Antibody [NBP1-89104] - Staining of human salivary gland shows moderate to strong nuclear positivity in ductal cells.
Knockdown Validated: RUNX2/CBFA1 Antibody [NBP1-89104]

Western Blot: RUNX2/CBFA1 Antibody [NBP1-89104]

Knockdown Validated: RUNX2/CBFA1 Antibody [NBP1-89104] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for RUNX2/CBFA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Frozen

Reported in scientific literature (PMID: 30888720)

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RUNX2/CBFA1

Runt-related transcription factor 2 (RUNX2), also known as CBFA1, AML-3, PEBP-2alphaA, and OSF-2, is a transcription factor that places a critical role in osteoblast differentiation and bone development (1-3). RUNX2 is a DNA-binding protein that belongs to the RUNX family which share a common runt domain (3). RUNX2 has two main isoforms which vary based on the two promoter regions (3). The main canonical isoform (P1) has MASN/DS at its N-terminus while the other (P2) isoform includes a MRIPV pentapeptide at its N-terminus (3). The RUNX2 P1 isoform has a theoretical molecular weight of 56 kDa and is synthesized as a 521 amino acid (aa) protein containing multiple domains. Specifically, RUNX2 contains transactivation domains (AD1, 2 and 3), a glutamine/alanine (Q/A)-rich domain, a runt homology domain (RHD), a nuclear localization signal (NLS), a proline/serine/threonine (PST)-rich domain, a nuclear matrix targeting signal (NMTS), a repression domain (RD), and a VWRPY region (3). RUNX2 is a heterodimer of an alpha and beta subunit where the alpha subunit binds DNA through the runt domain and the binding affinity is increased through heterodimerization (4).

Functionally, RUNX2 promotes the expression of osteoblast-specific genes vital for the osteoblast differentiation and proliferation process including type I collagen, osteocalcin (OCN), and alkaline phosphatase (APC) (1, 3). Further evidence for the role of RUNX2 is highlighted by a study of Runx2-/-mice which completely lack osteoblasts (4). Additionally, RUNX2 is also required for chondrocyte maturation, which are the cells responsible for cartilage formation (1, 3, 5). Given the role of RUNX2 in bone and cartilage maturation and formation, it is clear that defects or mutations in RUNX2 cause various bone and bone-related diseases (3, 6, 7). For instance, cleidocranial dysplasia (CCD), which presents with delayed cranial suture closure phenotypes, hypoplastic clavicles, extra teeth, and short stature, is caused by haploinsufficiency in RUNX2 (2, 3, 6). Furthermore, metaphyseal dysplasia with maxillary hypoplasia and brachydactyly (MDMHB) is a bone dysplasia disorder with a phenotype of abnormalities in the long bones, an underdeveloped jawbone, and short fingers that is caused by a duplication in RUNX2 (6). Finally, RUNX2 has been shown to be upregulated in mouse models of the joint disorder osteoarthritis (OA) and may be a potential molecular target for disease treatment (7).

Alternative names for RUNX2 include Acute myeloid leukemia 3 protein CBFA1, CBF-alpha-1, CCD1, CCDAML3, CLCD, Core-binding factor subunit alpha-1, MGC120023, ML3, oncogene AML-3, OSF2, osteoblast-specific transcription factor 2, PEA2aA, PEA2-alpha A, PEBP2A, polyomavirus enhancer-binding protein 2 alpha A subunit, runt related transcription factor 2, SL3/AKV core-binding factor alpha A subunit, and SL3-3 enhancer factor 1 alpha A subunit.

References

1. Ferreira, L. B., Gimba, E., Vinagre, J., Sobrinho-Simoes, M., & Soares, P. (2020). Molecular Aspects of Thyroid Calcification. International journal of molecular sciences. https://doi.org/10.3390/ijms21207718

2. Kim, W. J., Shin, H. L., Kim, B. S., Kim, H. J., & Ryoo, H. M. (2020). RUNX2-modifying enzymes: therapeutic targets for bone diseases. Experimental & molecular medicine. https://doi.org/10.1038/s12276-020-0471-4

3. Vimalraj, S., Arumugam, B., Miranda, P. J., & Selvamurugan, N. (2015). Runx2: Structure, function, and phosphorylation in osteoblast differentiation. International journal of biological macromolecules. https://doi.org/10.1016/j.ijbiomac.2015.04.008

4. Uniprot (Q13950)

5. Komori T. (2017). Roles of Runx2 in Skeletal Development. Advances in experimental medicine and biology. https://doi.org/10.1007/978-981-10-3233-2_6

6. Moffatt, P., Ben Amor, M., Glorieux, F. H., Roschger, P., Klaushofer, K., Schwartzentruber, J. A., Paterson, A. D., Hu, P., Marshall, C., FORGE Canada Consortium, Fahiminiya, S., Majewski, J., Beaulieu, C. L., Boycott, K. M., & Rauch, F. (2013). Metaphyseal dysplasia with maxillary hypoplasia and brachydactyly is caused by a duplication in RUNX2. American journal of human genetics. https://doi.org/10.1016/j.ajhg.2012.12.001

7. Chen, D., Kim, D. J., Shen, J., Zou, Z., & O'Keefe, R. J. (2019). Runx2 plays a central role in Osteoarthritis development. Journal of orthopaedic translation. https://doi.org/10.1016/j.jot.2019.11.008

Long Name

Runt-related Transcription Factor 2

Alternate Names

CBFA1

Gene Symbol

RUNX2

Additional RUNX2/CBFA1 Products

Product Documents for RUNX2/CBFA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RUNX2/CBFA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RUNX2/CBFA1 Antibody - BSA Free

Customer Reviews for RUNX2/CBFA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RUNX2/CBFA1 Antibody - BSA Free and earn rewards!

Have you used RUNX2/CBFA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RUNX2/CBFA1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
    • Q: We would like an anti-RUNX2 for IHC-P which share cross reactivity with Rat, but not with Human.

      A: We don't have any data for our RUNX2 antibodies that confirms they will NOT detect the human protein. When we can confirm that an antibody will not react with a certain species, we display a (-) sign on the datasheet. Otherwise, if the species is not listed it means that it has not been tested.
Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies