Serpin A8/Angiotensinogen Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35581

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Serpin A8/Angiotensinogen Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 35-485 of human Serpin A8/Angiotensinogen (NP_000020.1).

Sequence:
RVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Serpin A8/Angiotensinogen Antibody - BSA Free

Serpin A8/Angiotensinogen Antibody

Immunohistochemistry: Serpin A8/Angiotensinogen Antibody [NBP3-35581] -

Immunohistochemistry: Serpin A8/Angiotensinogen Antibody [NBP3-35581] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using Serpin A8/Angiotensinogen Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Serpin A8/Angiotensinogen Antibody

Immunohistochemistry: Serpin A8/Angiotensinogen Antibody [NBP3-35581] -

Immunohistochemistry: Serpin A8/Angiotensinogen Antibody [NBP3-35581] - Immunohistochemistry analysis of paraffin-embedded Human placenta using Serpin A8/Angiotensinogen Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Serpin A8/Angiotensinogen Antibody

Western Blot: Serpin A8/Angiotensinogen Antibody [NBP3-35581] -

Western Blot: Serpin A8/Angiotensinogen Antibody [NBP3-35581] - Western blot analysis of various lysates using Serpin A8/Angiotensinogen Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Serpin A8/Angiotensinogen Antibody

Immunocytochemistry/ Immunofluorescence: Serpin A8/Angiotensinogen Antibody [NBP3-35581] -

Immunocytochemistry/ Immunofluorescence: Serpin A8/Angiotensinogen Antibody [NBP3-35581] - Immunofluorescence analysis of HepG2 cells using Serpin A8/Angiotensinogen Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Serpin A8/Angiotensinogen Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Serpin A8/Angiotensinogen

Angiotensin II is encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.

Alternate Names

AGT, Angiotensin II, Angiotensinogen, Aogen, PAT

Gene Symbol

AGT

Additional Serpin A8/Angiotensinogen Products

Product Documents for Serpin A8/Angiotensinogen Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Serpin A8/Angiotensinogen Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Serpin A8/Angiotensinogen Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Serpin A8/Angiotensinogen Antibody - BSA Free and earn rewards!

Have you used Serpin A8/Angiotensinogen Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies