Serpin B5/Maspin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87780

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Rat

Predicted:

Mouse (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Serpin B5/Maspin Antibody - BSA Free

Knockdown Validated: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and MASPIN/Serpin B5 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.5 ug/ml of Rabbit Anti-Human MASPIN/Serpin B5 Polyclonal Antibody (Catalog # NBP1-87780) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for MASPIN/Serpin B5 at approximately 40 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Analysis in human skin and skeletal muscle tissues. Corresponding SERPINB5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human cerebral cortex, liver, skin and testis using Anti-SERPINB5 antibody NBP1-87780 (A) shows similar protein distribution across tissues to independent antibody NBP1-87779 (B).
Western Blot: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western Blot: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780] - Analysis in human cell lines PC-3 and Caco-2 using anti-SERPINB5 antibody. Corresponding SERPINB5 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: Serpin B5/Maspin Antibody [NBP1-87780]

Immunocytochemistry/ Immunofluorescence: Serpin B5/Maspin Antibody [NBP1-87780]

Immunocytochemistry/Immunofluorescence: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human cerebral cortex.
Western Blot: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780]

Western Blot: Serpin B5/Maspin Antibody [NBP1-87780] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human testis.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human liver.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human skin shows strong positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780]

Immunohistochemistry-Paraffin: Serpin B5/Maspin Antibody [NBP1-87780] - Staining of human upper gastrointestinal shows weak to moderate cytoplasmic/membranous positivity in glandular cells.

Applications for Serpin B5/Maspin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Serpin B5/Maspin

Maspin is an extracellular matrix tumor supressor that blocks the growth, invasion, and metastatic properties of mammary and prostate tumors. Structurally Maspin is a serine protease inhibitor (Serpin), but it does not undergo the stressed to relaxed conformational transition characteristic of active serpins and exhibits no serine protease inhibitory activity. Maspin is also expressed by the corneal epithelium and regulates migration and adhesion of corneal stromal fibroblasts and myofibroblasts during corneal wound healing.

Alternate Names

Maspin, PI5

Gene Symbol

SERPINB5

Additional Serpin B5/Maspin Products

Product Documents for Serpin B5/Maspin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Serpin B5/Maspin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Serpin B5/Maspin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Serpin B5/Maspin Antibody - BSA Free and earn rewards!

Have you used Serpin B5/Maspin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...