SF3B2 Antibody (5D2) - Azide and BSA Free

Novus Biologicals | Catalog # H00010992-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5D2

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY

Specificity

SF3B2 (5D2)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for SF3B2 Antibody (5D2) - Azide and BSA Free

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01]

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01]

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01] - SF3B2 monoclonal antibody (M01), clone 5D2 Analysis of SF3B2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: SF3B2 Antibody (5D2) [H00010992-M01]

Immunocytochemistry/ Immunofluorescence: SF3B2 Antibody (5D2) [H00010992-M01]

Immunocytochemistry/Immunofluorescence: SF3B2 Antibody (5D2) [H00010992-M01] - Analysis of monoclonal antibody to SF3B2 on HeLa cell. Antibody concentration 60 ug/ml.
Immunohistochemistry-Paraffin: SF3B2 Antibody (5D2) [H00010992-M01]

Immunohistochemistry-Paraffin: SF3B2 Antibody (5D2) [H00010992-M01]

Immunohistochemistry-Paraffin: SF3B2 Antibody (5D2) [H00010992-M01] - Analysis of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 6 ug/ml.
Western Blot: SF3B2 Antibody (5D2) [H00010992-M01]

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01]

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01] - SF3B2 monoclonal antibody (M01), clone 5D2. Analysis of SF3B2 expression in PC-12.
Western Blot: SF3B2 Antibody (5D2) [H00010992-M01]

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01]

Western Blot: SF3B2 Antibody (5D2) [H00010992-M01] - SF3B2 monoclonal antibody (M01), clone 5D2. Analysis of SF3B2 expression in NIH/3T3.

Applications for SF3B2 Antibody (5D2) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: SF3B2

This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.

Alternate Names

Cus1, pre-mRNA splicing factor SF3b 145 kDa subunit, Pre-mRNA-splicing factor SF3b 145 kDa subunit, SAP145SAP 145, SF3b1, SF3B145, SF3b150, spliceosome associated protein 145, Spliceosome-associated protein 145, splicing factor 3B subunit 2, splicing factor 3b, subunit 2, 145kD, splicing factor 3b, subunit 2, 145kDa

Entrez Gene IDs

10992 (Human); 319322 (Mouse); 293671 (Rat)

Gene Symbol

SF3B2

OMIM

605591 (Human)

Additional SF3B2 Products

Product Documents for SF3B2 Antibody (5D2) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SF3B2 Antibody (5D2) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SF3B2 Antibody (5D2) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review SF3B2 Antibody (5D2) - Azide and BSA Free and earn rewards!

Have you used SF3B2 Antibody (5D2) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...