SFPQ Antibody (8Y5S6)

Novus Biologicals | Catalog # NBP3-33527

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8Y5S6
View all SFPQ Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 600-707 of human SFPQ (P23246).

Sequence:
MGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SFPQ Antibody (8Y5S6)

SFPQ Antibody (8Y5S6)

Western Blot: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Western Blot: SFPQ Antibody (8Y5S6) [NBP3-33527] - Western blot analysis of various lysates using SFPQ Rabbit mAb at 1:200 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
SFPQ Antibody (8Y5S6)

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of HeLa cells using SFPQ Rabbit mAb (A3494) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
SFPQ Antibody (8Y5S6)

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of C6 cells using SFPQ Rabbit mAb (A3494) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunocytochemistry/ Immunofluorescence: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunofluorescence analysis of NIH-3T3 cells using SFPQ Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse heart tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
SFPQ Antibody (8Y5S6)

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] -

Immunohistochemistry: SFPQ Antibody (8Y5S6) [NBP3-33527] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using SFPQ Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for SFPQ Antibody (8Y5S6)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SFPQ

PSF/SFPQ is a multifunctional protein know to participate in a variety of nuclear processes and may function to link transcription and pre-mRNA processing. PSF/SFPQ bears an RNA recognition motif (RRM) further indicating its role in post-transcriptional processes. PSF has been shown to associate with p54nrb/NonO to modulate androgen receptor-mediated transcription. Additionally, it has recently been show to associate with XRN2 and p54nrb/NonO to facilitate pre-mRNA 3' processing and transcription termination. Alternate names for PSF/SFPQ include polypyrimidine tract-binding protein-associated-splicing factor, PTB-associated-splicing factor, splicing factor proline-and glutamine-rich, and POMP100.

Alternate Names

100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich

Gene Symbol

SFPQ

Additional SFPQ Products

Product Documents for SFPQ Antibody (8Y5S6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SFPQ Antibody (8Y5S6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFPQ Antibody (8Y5S6)

There are currently no reviews for this product. Be the first to review SFPQ Antibody (8Y5S6) and earn rewards!

Have you used SFPQ Antibody (8Y5S6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies