SFRS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38224

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SFRS3 (NP_003008.1).

Sequence:
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SFRS3 Antibody - BSA Free

SFRS3 Antibody

Immunocytochemistry/ Immunofluorescence: SFRS3 Antibody [NBP3-38224] -

Immunocytochemistry/ Immunofluorescence: SFRS3 Antibody [NBP3-38224] - Immunofluorescence analysis of U-2 OS cells using SFRS3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SFRS3 Antibody

Immunohistochemistry: SFRS3 Antibody [NBP3-38224] -

Immunohistochemistry: SFRS3 Antibody [NBP3-38224] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using SFRS3 Rabbit pAb at dilution of 1:100 (20x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SFRS3 Antibody

Immunocytochemistry/ Immunofluorescence: SFRS3 Antibody [NBP3-38224] -

Immunocytochemistry/ Immunofluorescence: SFRS3 Antibody [NBP3-38224] - Immunofluorescence analysis of NIH/3T3 cells using SFRS3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SFRS3 Antibody

Immunohistochemistry: SFRS3 Antibody [NBP3-38224] -

Immunohistochemistry: SFRS3 Antibody [NBP3-38224] - Immunohistochemistry analysis of paraffin-embedded Human mammary cancer using SFRS3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SFRS3 Antibody

Western Blot: SFRS3 Antibody [NBP3-38224] -

Western Blot: SFRS3 Antibody [NBP3-38224] - Western blot analysis of various lysates using SFRS3 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
SFRS3 Antibody

Immunocytochemistry/ Immunofluorescence: SFRS3 Antibody [NBP3-38224] -

Immunocytochemistry/ Immunofluorescence: SFRS3 Antibody [NBP3-38224] - Immunofluorescence analysis of C6 cells using SFRS3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SFRS3 Antibody

Immunohistochemistry: SFRS3 Antibody [NBP3-38224] -

Immunohistochemistry: SFRS3 Antibody [NBP3-38224] - Immunohistochemistry analysis of paraffin-embedded Rat brain using SFRS3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for SFRS3 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:100 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SFRS3

SFRS3 may be involved in RNA processing in relation with cellular proliferation and/or maturation

Alternate Names

Pre-mRNA-splicing factor SRP20, serine/arginine-rich splicing factor 3, SFRS3splicing factor, arginine/serine-rich, 20-kD, Splicing factor, arginine/serine-rich 3SRP20, SRp20

Gene Symbol

SRSF3

Additional SFRS3 Products

Product Documents for SFRS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SFRS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS3 Antibody - BSA Free and earn rewards!

Have you used SFRS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...