SIRP alpha/CD172a Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58429

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK

Reactivity Notes

Mouse 81%, Rat 81%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SIRP alpha/CD172a Antibody - BSA Free

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-58429 antibody. Corresponding SIRPA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human cerebellum, cerebral cortex, pancreas and skeletal muscle using Anti-SIRPA antibody NBP2-58429 (A) shows similar protein distribution across tissues to independent antibody NBP2-56723 (B).
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in granular layer.
Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429]

Immunohistochemistry-Paraffin: SIRP alpha/CD172a Antibody [NBP2-58429] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for SIRP alpha/CD172a Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SIRP alpha/CD172a

Protein tyrosine phosphatases (PTPases) SHP-1 and SHP-2 are critical regulators in the intracellular signaling pathways that result in cell responses such as mitosis, differentiation, migration, survival, transformation or death. SHP-2 is a signal transducer for several receptor tyrosine kinases and cytokine receptors. A novel SHP-2 associated glycoprotein was recently cloned from human, rat, mouse and cattle by several labs and was designated SIRPa (1), SHPS-1 (2,3), MyD-1 (4), BIT (5,6) and p84 (7). SIRPa is a new gene family containing at least fifteen members. SIRPa is a substrate of many activated tyrosine kinases such as insulin receptor, EGFR, PDGFR and src, and a specific docking protein for SHP-2 (1,2,5,8). SIRPa has regulatory effects on cellular responses induced by serum, growth factors, insulin, oncogenes, growth hormones and cell adhesion and plays a general role in different physiological and pathological processes (1,2,5,8).

Long Name

Signal-regulatory Protein alpha

Alternate Names

BIT, CD172a, MFR, MYD-1, SHPS1, SIRPA

Gene Symbol

SIRPA

Additional SIRP alpha/CD172a Products

Product Documents for SIRP alpha/CD172a Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SIRP alpha/CD172a Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SIRP alpha/CD172a Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SIRP alpha/CD172a Antibody - BSA Free and earn rewards!

Have you used SIRP alpha/CD172a Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies