Smad1 Antibody (7H7L5)
Novus Biologicals | Catalog # NBP3-15670
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Human, Mouse
Applications
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7H7L5 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-240 of human Smad1 (NP_005891.1). WKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Smad1 Antibody (7H7L5)
Western Blot: Smad1 Antibody (7H7L5) [Smad1] -
Western Blot: Smad1 Antibody (7H7L5) [Smad1] - Western blot analysis of lysates from wild type(WT) and Smad1 Rabbit mAb knockout (KO) HeLa(KO) cells, using Smad1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Immunohistochemistry-Paraffin: Smad1 Antibody (7H7L5) [NBP3-15670]
Immunohistochemistry-Paraffin: Smad1 Antibody (4W2M9) [NBP3-15670] - Immunohistochemistry of paraffin-embedded mouse spinal cord using Smad1 antibody (NBP3-15670) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Western Blot: Smad1 Antibody (7H7L5) [Smad1] -
Western Blot: Smad1 Antibody (7H7L5) [Smad1] - Western blot analysis of lysates from Mouse brain, using Smad1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
Smad1 Antibody (7H7L5) [Smad1] -
Smad1 from 400 µg extracts of HeLa cells was performed using 2 µg of [KO Validated] Smad1 Rabbit mAb. Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] Smad1 Rabbit mAb at a dilution of 1:500.Applications for Smad1 Antibody (7H7L5)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunohistochemistry
1:100 - 1:500
Immunohistochemistry-Paraffin
1:100 - 1:500
Immunoprecipitation
0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Smad1
Long Name
Mothers Against DPP Homolog 1
Alternate Names
BSP1, BSP-1, hSMAD1, JV4-1SMAD, mothers against DPP homolog 1 (Drosophila), MAD homolog 1, MADH1JV41, MADR1MAD, mothers against decapentaplegic homolog 1 (Drosophila), Mad-related protein 1, mothers against decapentaplegic homolog 1, Mothers against DPP homolog 1, SMAD family member 1SMAD 1, SMAD, mothers against DPP homolog 1, Smad1, TGF-beta signaling protein 1, transforming growth factor-beta signaling protein 1
Gene Symbol
SMAD1
Additional Smad1 Products
Product Documents for Smad1 Antibody (7H7L5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Smad1 Antibody (7H7L5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Smad1 Antibody (7H7L5)
There are currently no reviews for this product. Be the first to review Smad1 Antibody (7H7L5) and earn rewards!
Have you used Smad1 Antibody (7H7L5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...