Smad4 Antibody (6B4D6)

Novus Biologicals | Catalog # NBP3-15673

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6B4D6 expressed in HEK293
View all Smad4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 320-552 of human Smad4 (NP_005350.1). PEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Smad4 Antibody (6B4D6)

Knockout Validated: Smad4 Antibody (6B4D6) [NBP3-15673]

Western Blot: Smad4 Antibody (6B4D6) [NBP3-15673]

Western Blot: Smad4 Antibody (1H7D3) [NBP3-15673] - Western blot analysis of extracts from normal (control) and Smad4 knockout (KO) 293T cells, using Smad4 antibody (NBP3-15673) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Smad4 Antibody (6B4D6)

Western Blot: Smad4 Antibody (1H7D3) [NBP3-15673] -

Western Blot: Smad4 Antibody (1H7D3) [NBP3-15673] -Analysis of various lysates using [KO Validated] Smad4 Rabbit mAb at 1:1000 dilution incubated overnight at 4c.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.
Smad4 Antibody (6B4D6)

Western Blot: Smad4 Antibody (6B4D6) [Smad4] -

Western Blot: Smad4 Antibody (6B4D6) [Smad4] - Western blot analysis of various lysates using [KO Validated] Smad4 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
Smad4 Antibody (6B4D6)

Immunohistochemistry-Paraffin: Smad4 Antibody (1H7D3) [NBP3-15673] -

Immunohistochemistry-Paraffin: Smad4 Antibody (1H7D3) [NBP3-15673] - Analysis of paraffin-embedded Human placenta tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Smad4 Antibody (6B4D6)

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] -

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Smad4 Antibody (6B4D6)

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] -

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Smad4 Antibody (6B4D6)

Chromatin Immunoprecipitation: Smad4 Antibody (6B4D6) [Smad4] -

Chromatin Immunoprecipitation: Smad4 Antibody (6B4D6) [Smad4] - Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using [KO Validated] Smad4 Rabbit mAb and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Smad4 Antibody (6B4D6)

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] -

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Smad4 Antibody (6B4D6)

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] -

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Smad4 Antibody (6B4D6)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5ug antibody for 10μg-15μg of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunohistochemistry

1:500 - 1:2000

Immunohistochemistry-Paraffin

1:500 - 1:2000

Immunoprecipitation

0.5ug-4ug antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Smad4

Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad) have been implicated as downstream effectors of TGFbeta/BMP signaling. Smad1 (also designated Madr1 or JV4-1), Smad5 and mammalian Smad8 (also designated Smad9 or MadH6) are effectors of BMP2 and BMP4 function while Smad2 (also designated Madr2 or JV18-1) and Smad3 are involved in TGFbeta and activin-mediated growth modulation. Smad4 (also designated DPC4) has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFbeta signaling by interfering with TGFbeta-mediated phosphorylation of other Smad family members.

Long Name

Mothers Against DPP Homolog 4

Alternate Names

DPC4, MADH4

Gene Symbol

SMAD4

Additional Smad4 Products

Product Documents for Smad4 Antibody (6B4D6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Smad4 Antibody (6B4D6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Smad4 Antibody (6B4D6)

There are currently no reviews for this product. Be the first to review Smad4 Antibody (6B4D6) and earn rewards!

Have you used Smad4 Antibody (6B4D6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies