SMARCA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38986

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMARCA6 Antibody - BSA Free

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Analysis in human testis and pancreas tissues. Corresponding HELLS RNA-seq data are presented for the same tissues.
Western Blot: SMARCA6 Antibody [NBP2-38986]

Western Blot: SMARCA6 Antibody [NBP2-38986]

Western Blot: SMARCA6 Antibody [NBP2-38986] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: SMARCA6 Antibody [NBP2-38986]

Immunocytochemistry/ Immunofluorescence: SMARCA6 Antibody [NBP2-38986]

Immunocytochemistry/Immunofluorescence: SMARCA6 Antibody [NBP2-38986] - Staining of human cell line MCF7 shows localization to nucleus, the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human pancreas shows no positivity as expected.
Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986]

Immunohistochemistry-Paraffin: SMARCA6 Antibody [NBP2-38986] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.

Applications for SMARCA6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SMARCA6

HELLS, also known as LSH (lymphoid specific helicase), is a member of the SNF2 superfamily of chromatin helicases. HELLS is ubiquitously expressed and is required for the maintenance of normal DNA methylation patterns important to organism development. HELLS function has also been shown to be important to the regulation of proliferation and the expression of senescence-related genes.

Alternate Names

EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6

Gene Symbol

HELLS

UniProt

Additional SMARCA6 Products

Product Documents for SMARCA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMARCA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMARCA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SMARCA6 Antibody - BSA Free and earn rewards!

Have you used SMARCA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...