SNIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89428

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SNIP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNIP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SNIP1 Antibody [NBP1-89428]

Immunocytochemistry/ Immunofluorescence: SNIP1 Antibody [NBP1-89428]

Immunocytochemistry/Immunofluorescence: SNIP1 Antibody [NBP1-89428] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
SNIP1 Antibody - BSA Free Immunohistochemistry-Paraffin: SNIP1 Antibody - BSA Free [NBP1-89428]

Immunohistochemistry-Paraffin: SNIP1 Antibody - BSA Free [NBP1-89428]

Analysis in human testis and pancreas tissues using Anti-SNIP1 antibody. Corresponding SNIP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SNIP1 Antibody [NBP1-89428]

Immunohistochemistry-Paraffin: SNIP1 Antibody [NBP1-89428]

Immunohistochemistry-Paraffin: SNIP1 Antibody [NBP1-89428] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: SNIP1 Antibody [NBP1-89428]

Immunohistochemistry-Paraffin: SNIP1 Antibody [NBP1-89428]

Immunohistochemistry-Paraffin: SNIP1 Antibody [NBP1-89428] - Staining of human pancreas shows low expression as expected.
SNIP1 Antibody - BSA Free Western Blot: SNIP1 Antibody - BSA Free [NBP1-89428]

Western Blot: SNIP1 Antibody - BSA Free [NBP1-89428]

Analysis in control (vector only transfected HEK293T lysate) and SNIP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for SNIP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNIP1

Members of the transforming growth factor-beta superfamily play critical roles in controlling cell growth and differentiation. Effects of TGF-beta family ligands are mediated by Smad proteins. A 396-amino acid nuclear protein termed SNIP1 was cloned and shown to harbor a nuclear localization signal (NLS) and a Forkhead-associated (FHA) domain. The carboxyl terminus of SNIP1 interacts with Smad1 and Smad2 in yeast two-hybrid as well as in mammalian overexpression systems. However, the amino terminus of SNIP1 harbors binding sites for both Smad4 and the coactivator CBP/p300. Overexpression of full-length SNIP1 or its amino terminus is sufficient to inhibit multiple gene responses to TGF-beta and CBP/p300, as well as the formation of a Smad4/p300 complex. Studies in Xenopus laevis further suggest that SNIP1 plays a role in regulating dorsomedial mesoderm formation by the TGF-beta family member nodal. Thus, SNIP1 is a nuclear inhibitor of CBP/p300 and its level of expression in specific cell types has important physiological consequences by setting a threshold for TGF-beta-induced transcriptional activation involving CBP/p300.

Alternate Names

dJ423B22.2, FHA domain-containing protein SNIP1, FLJ12553, RP3-423B22.3, Smad nuclear interacting protein (SNIP1), Smad nuclear interacting protein 1, smad nuclear-interacting protein 1

Gene Symbol

SNIP1

Additional SNIP1 Products

Product Documents for SNIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNIP1 Antibody - BSA Free and earn rewards!

Have you used SNIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies