Sodium Potassium ATPase Alpha 1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-95255
![Western Blot: Sodium Potassium ATPase Alpha 1 AntibodyAzide and BSA Free [NBP2-95255]](https://resources.rndsystems.com/images/products/Sodium%20Potassium%20ATPase%20Alpha%201%20Antibody-Western%20Blot-NBP2-95255-img0004.jpg "Western Blot: Sodium Potassium ATPase Alpha 1 AntibodyAzide and BSA Free [NBP2-95255]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (NP_000692.2). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free
Western Blot: Sodium Potassium ATPase Alpha 1 AntibodyAzide and BSA Free [NBP2-95255]
Western Blot: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-95255] - Western blot analysis of extracts of various cell lines, using Sodium Potassium ATPase Alpha 1 antibody (NBP2-95255) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.![Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]](https://resources.rndsystems.com/images/products/Sodium-Potassium-ATPase-Alpha-1-Antibody-Immunohistochemistry-Paraffin-NBP2-95255-img0003.jpg "Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]")
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-95255] - Immunohistochemistry of paraffin-embedded mouse kidney using Sodium Potassium ATPase Alpha 1 Rabbit pAb (NBP2-95255) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]](https://resources.rndsystems.com/images/products/Sodium-Potassium-ATPase-Alpha-1-Antibody-Immunohistochemistry-Paraffin-NBP2-95255-img0001.jpg "Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]")
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-95255] - Immunohistochemistry of paraffin-embedded human liver cancer using Sodium Potassium ATPase Alpha 1 Rabbit pAb (NBP2-95255) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]](https://resources.rndsystems.com/images/products/Sodium-Potassium-ATPase-Alpha-1-Antibody-Immunohistochemistry-Paraffin-NBP2-95255-img0002.jpg "Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]")
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [NBP2-95255]
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 1 Antibody [NBP2-95255] - Immunohistochemistry of paraffin-embedded human lung cancer using Sodium Potassium ATPase Alpha 1 Rabbit pAb (NBP2-95255) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [Sodium Potassium ATPase Alpha 1] -
Immunocytochemistry/ Immunofluorescence: Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free [Sodium Potassium ATPase Alpha 1] - Immunofluorescence analysis of paraffin-embedded Mouse colon tissue using Sodium Potassium ATPase Alpha 1 Rabbit pAb at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Applications for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:100 - 1:500
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Sodium Potassium ATPase Alpha 1
Long Name
Sodium/potassium-transporting ATPase subunit alpha-1
Alternate Names
ATP1A1, EC 7.2.2.13
Gene Symbol
ATP1A1
Additional Sodium Potassium ATPase Alpha 1 Products
Product Documents for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Sodium Potassium ATPase Alpha 1 Antibody - BSA Free and earn rewards!
Have you used Sodium Potassium ATPase Alpha 1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Sodium Potassium ATPase Alpha 1 Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: I am looking forward to pick up a plasma membrane marker. I have gastric cancer cell line and I am preparing PM out of that. To just check the quality of prep, I need a plasma membrane marker.
A:
Our sodium potassium ATPase and plasma membrane products may be of use to you. Please contact us at technical@novusbio.com with any additional questions.
Loading...