Sorbitol Dehydrogenase Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37912

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 145-300 of human Sorbitol Dehydrogenase (NP_003095.2).

Sequence:
DNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Sorbitol Dehydrogenase Antibody - BSA Free

Sorbitol Dehydrogenase Antibody

Western Blot: Sorbitol Dehydrogenase Antibody [NBP3-37912] -

Western Blot: Sorbitol Dehydrogenase Antibody [NBP3-37912] - Western blot analysis of various lysates using Sorbitol Dehydrogenase Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Sorbitol Dehydrogenase Antibody

Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP3-37912] -

Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP3-37912] - Immunofluorescence analysis of NIH/3T3 cells using Sorbitol Dehydrogenase Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Sorbitol Dehydrogenase Antibody

Immunohistochemistry: Sorbitol Dehydrogenase Antibody [NBP3-37912] -

Immunohistochemistry: Sorbitol Dehydrogenase Antibody [NBP3-37912] - Immunohistochemistry analysis of paraffin-embedded Human kidney using Sorbitol Dehydrogenase Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Sorbitol Dehydrogenase Antibody

Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP3-37912] -

Immunocytochemistry/ Immunofluorescence: Sorbitol Dehydrogenase Antibody [NBP3-37912] - Immunofluorescence analysis of Huh7 cells using Sorbitol Dehydrogenase Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Sorbitol Dehydrogenase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sorbitol Dehydrogenase

Sorbitol dehydrogenase (SDH), a member of the medium-chain dehydrogenase/reductase protein family and the second enzyme of the polyol pathway of glucose metabolism, converts sorbitol to fructose strictly using NAD(+) as coenzyme. SDH is expressed almost ubiquitously in all mammalian tissues. The enzyme has attracted considerable interest due to its implication in the development of diabetic complications as the polyol pathway is particularly active in hyperglycemic states. Although SORD is closely related to the class I long-chain alcohol dehydrogenases, it differs in substrate specificity, catalyzing polyols such as sorbitol and xylitol but having no activity towards primary alcohols.

Alternate Names

EC 1.1.1, EC 1.1.1.14, L-iditol 2-dehydrogenase, sorbitol dehydrogenase, SORD1

Gene Symbol

SORD

Additional Sorbitol Dehydrogenase Products

Product Documents for Sorbitol Dehydrogenase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sorbitol Dehydrogenase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sorbitol Dehydrogenase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sorbitol Dehydrogenase Antibody - BSA Free and earn rewards!

Have you used Sorbitol Dehydrogenase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...