STEAP3/TSAP6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13395

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all STEAP3/TSAP6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for STEAP3/TSAP6 Antibody - BSA Free

Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395]

Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395]

Western Blot: STEAP3/TSAP6 Antibody [NBP2-13395] - Analysis in human cell line PC-3 and human cell line SK-MEL-30.
Immunocytochemistry/ Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395]

Immunocytochemistry/ Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395]

Immunocytochemistry/Immunofluorescence: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human cell line U-2 OS shows localization to nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395]

Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395]

Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human liver shows strong cytoplasmic and membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395]

Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395]

Immunohistochemistry-Paraffin: STEAP3/TSAP6 Antibody [NBP2-13395] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.
STEAP3/TSAP6 Antibody - BSA Free Western Blot: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Western Blot: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Analysis in human cell line PC-3 and human cell line SK-MEL-30.
STEAP3/TSAP6 Antibody - BSA Free Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Staining of human Liver shows strong membranous and cytoplasmic positivity in hepatocytes.
STEAP3/TSAP6 Antibody - BSA Free Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Staining of human Duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.
STEAP3/TSAP6 Antibody - BSA Free Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Staining of human Breast shows strong membranous and cytoplasmic positivity in glandular cells.
STEAP3/TSAP6 Antibody - BSA Free Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Immunohistochemistry: STEAP3/TSAP6 Antibody - BSA Free [NBP2-13395]

Staining of human Fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.

Applications for STEAP3/TSAP6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STEAP3/TSAP6

STEAP3 is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell cell junctions.

Long Name

Six Transmembrane Epithelial Antigen of the Prostate 3

Alternate Names

AHMIO2, Dudlin-2, pHyde, STMP3, TSAP6

Gene Symbol

STEAP3

Additional STEAP3/TSAP6 Products

Product Documents for STEAP3/TSAP6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for STEAP3/TSAP6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Redox Enzymes

Customer Reviews for STEAP3/TSAP6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STEAP3/TSAP6 Antibody - BSA Free and earn rewards!

Have you used STEAP3/TSAP6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies