Talin2 Antibody (7D1Y0)

Novus Biologicals | Catalog # NBP3-15932

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7D1Y0 expressed in HEK293
View all Talin2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Talin2 (Q9Y4G6). VLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRTGKAEHGSV

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

272 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Talin2 Antibody (7D1Y0)

Western Blot: Talin2 Antibody (7D1Y0) [NBP3-15932]

Western Blot: Talin2 Antibody (7D1Y0) [NBP3-15932]

Western Blot: Talin2 Antibody (7D1Y0) [NBP3-15932] - Western blot analysis of extracts of various cell lines, using Talin2 Rabbit mAb (NBP3-15932) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Talin2 Antibody (7D1Y0)

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] -

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Talin2 Antibody (7D1Y0)

Immunocytochemistry/ Immunofluorescence: Talin2 Antibody (7D1Y0) [Talin2] -

Immunocytochemistry/ Immunofluorescence: Talin2 Antibody (7D1Y0) [Talin2] - Confocal imaging of paraffin-embedded Mouse brain tissue using Talin2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Talin2 Antibody (7D1Y0)

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] -

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Talin2 Antibody (7D1Y0)

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] -

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Talin2 Antibody (7D1Y0)

Immunocytochemistry/ Immunofluorescence: Talin2 Antibody (7D1Y0) [Talin2] -

Immunocytochemistry/ Immunofluorescence: Talin2 Antibody (7D1Y0) [Talin2] - Confocal imaging of paraffin-embedded Rat brain tissue using Talin2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Talin2 Antibody (7D1Y0)

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] -

Immunohistochemistry: Talin2 Antibody (7D1Y0) [Talin2] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Talin2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Talin2 Antibody (7D1Y0)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:100 - 1:400

Immunohistochemistry

1:500 - 1:2000

Immunohistochemistry-Paraffin

1:500 - 1:2000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Talin2

Talin2 (talus; Latin for ankle, the shape of a focal adhesion plaque complex) is a 240 kDa cytoplasmic focal adhesion molecule. It likely forms dimers that link integrins to the actin cytoskeleton. Human Talin2 is 2542 amino acids (aa) in length. It contains one globular N-terminal FERM domain that binds integrin cytodomains (aa 88-406), followed by an Ala-rich region (aa 861-1193) and a C-terminal actin-binding domain (aa 2321-2530). Human Talin2 has three potential variants. Two show alternate start sites at Met19 and Met1153, while a third has an alternate start site at Met1608 accompanied by a deletion of aa 1748-1790. Over aa's 977-1183, human Talin2 shares 99% and 97% aa identity with canine and mouse Talin2, respectively.

Alternate Names

ILWEQ, TLN2

Gene Symbol

TLN2

Additional Talin2 Products

Product Documents for Talin2 Antibody (7D1Y0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Talin2 Antibody (7D1Y0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Talin2 Antibody (7D1Y0)

There are currently no reviews for this product. Be the first to review Talin2 Antibody (7D1Y0) and earn rewards!

Have you used Talin2 Antibody (7D1Y0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies