TAZ/WWTR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85067

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Predicted:

Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, Knockdown Validated

Cited:

Immunohistochemistry-Paraffin, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TAZ/WWTR1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24658687)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit TAZ/WWTR1 Antibody - BSA Free (NBP1-85067) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-TAZ/WWTR1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for TAZ/WWTR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining in human placenta and skeletal muscle tissues. Corresponding WWTR1 RNA-seq data are presented for the same tissues.
Western Blot: TAZ/WWTR1 Antibody [NBP1-85067]

Western Blot: TAZ/WWTR1 Antibody [NBP1-85067]

Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/ Immunofluorescence: TAZ/WWTR1 Antibody [NBP1-85067]

Immunocytochemistry/ Immunofluorescence: TAZ/WWTR1 Antibody [NBP1-85067]

Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies and cytosol. Antibody staining is shown in green.
Western Blot: TAZ/WWTR1 Antibody [NBP1-85067]

Western Blot: TAZ/WWTR1 Antibody [NBP1-85067]

Western Blot: TAZ/WWTR1 Antibody [NBP1-85067] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human colon shows moderate to strong nuclear positivity in a subset of lymphoid cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human kidney shows moderate nuclear positivity in glomerular cells and a subset of cells in distal tubules.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human placenta shows moderate to strong nuclear positivity in endothelial cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human renal cancer shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067]

Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NBP1-85067] - Staining of human skeletal muscle shows weak positivity in myocytes.
Simple Western: TAZ/WWTR1 Antibody [NBP1-85067]

Simple Western: TAZ/WWTR1 Antibody [NBP1-85067]

Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Simple Western lane view shows a specific band for WWTR1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: TAZ/WWTR1 Antibody [NBP1-85067]

Simple Western: TAZ/WWTR1 Antibody [NBP1-85067]

Simple Western: TAZ/WWTR1 Antibody [NBP1-85067] - Electropherogram image(s) of corresponding Simple Western lane view. TAZ/WWTR1 antibody was used at 1:30 dilution on RT-4 lysates(s).

Applications for TAZ/WWTR1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:30

Western Blot

0.04-0.4 ug/ml
Application Notes

IHC reported in scientific literature (PMID:22190458). IHC-Paraffin HIER pH6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 58 kDa

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TAZ/WWTR1

TAZ (transcriptional co-activator with PDZ-binding motif) was identified as a binding partner of 14-3-3 family of proteins which contains seven homologous proteins with ability to bind phosphorylated serine with certain sequence motifs, thereby involving in diverse cellular functions such as differentiation, cell cycle progression and apoptosis via their interaction with diverse intracellular phosphoproteins involved in signaling networks. TAZ is homologous to YAP and displays transcriptional co-activator function via interaction with PPXY-containing transcriptional factors through its WW domain. Several transcriptional factors such as Runx/PEBP2, AP2, C/EBP, c-Jun, Krox-20, Krox-24, MEF2B, NF-E2, Oct-4 and p73 containing proline-rich PPXY motif have been proposed as TAZ's interacting partners and TAZ is a major target of Hippo core kinase cascade which regulates organ size control as well as stem cell properties by governing cell proliferation and apoptosis processes Hippo mediated phosphorylation of YAP and TAZ leads to their sequestration into cytoplasm by interaction with 14-3-3 proteins and ubiquitination-dependent proteosomal degradation, thereby governing its distribution, protein levels and functionality also. TAZ interact primarily with transcriptional factors TEAD1-4 (TEADs) and activate expression of target genes such as CTGF, IGFBP3, ITGB2, Birc5/Survivin, Gli2, and Axl.

Long Name

Transcriptional Coactivator with PDZ-binding Motif

Alternate Names

WWTR1

Entrez Gene IDs

25937 (Human)

Gene Symbol

WWTR1

UniProt

Q9GZV5 (Human)

Additional TAZ/WWTR1 Products

Product Documents for TAZ/WWTR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TAZ/WWTR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TAZ/WWTR1 Antibody - BSA Free

Customer Reviews for TAZ/WWTR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TAZ/WWTR1 Antibody - BSA Free and earn rewards!

Have you used TAZ/WWTR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TAZ/WWTR1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

    • A: I would recommend this TAZ antibody: NB110-58359. This is also comes in a sample size.
Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies