TEAD1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-95204

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP)

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all TEAD1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TEAD1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TEF1 Antibody - Azide and BSA Free [NBP2-95204]

Immunocytochemistry/ Immunofluorescence: TEF1 Antibody - Azide and BSA Free [NBP2-95204]

Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-95204] - Analysis of MCF7 cells using TEF1.
Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-95204] - Analysis of extracts of HeLa cells, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
TEAD1 Antibody - Azide and BSA Free

Immunoprecipitation: TEAD1 Antibody - Azide and BSA Free [TEAD1] -

Immunoprecipitation: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Immunoprecipitation of TEAD1 in 600 ug extracts from mouse heart using 3 ug TEAD1 Rabbit pAb. Western blot analysis was performed using TEAD1 Rabbit pAb at 1:200 dilution.
TEAD1 Antibody - Azide and BSA Free

Western Blot: TEAD1 Antibody - Azide and BSA Free [TEAD1] -

Western Blot: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Western blot analysis of lysates from Rat lung using TEAD1 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time:90s.
TEAD1 Antibody - Azide and BSA Free

Immunohistochemistry: TEAD1 Antibody - Azide and BSA Free [TEAD1] -

Immunohistochemistry: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Immunohistochemistry analysis of paraffin-embedded Human liver using TEAD1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TEAD1 Antibody - Azide and BSA Free

Immunohistochemistry: TEAD1 Antibody - Azide and BSA Free [TEAD1] -

Immunohistochemistry: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Immunohistochemistry analysis of paraffin-embedded Human lung using TEAD1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TEAD1 Antibody - Azide and BSA Free

Western Blot: TEAD1 Antibody - Azide and BSA Free [TEAD1] -

Western Blot: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Western blot analysis of various lysates using TEAD1 Rabbit pAb at 1:700 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 28s.

Applications for TEAD1 Antibody - Azide and BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5μg antibody for 10μg-15μg of Chromatin

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

5μg-4μg antibody for 400μg-600μg extracts of whole cells

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TEAD1

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.

Long Name

Transcriptional enhancer factor TEF-1

Alternate Names

AA, NTEF-1, protein GT-IIC, REF1, TCF13, TCF-13, TEA domain family member 1 (SV40 transcriptional enhancer factor), TEAD1, TEAD-1, TEF-1, transcription factor 13, transcriptional enhancer factor 1, transcriptional enhancer factor TEF-1

Gene Symbol

TEAD1

Additional TEAD1 Products

Product Documents for TEAD1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TEAD1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TEAD1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TEAD1 Antibody - Azide and BSA Free and earn rewards!

Have you used TEAD1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies