TFIIB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35718

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 40-154 of TFIIB(NP_001505.1).

Sequence:
VVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TFIIB Antibody - BSA Free

TFIIB Antibody

Immunocytochemistry/ Immunofluorescence: TFIIB Antibody [NBP3-35718] -

Immunocytochemistry/ Immunofluorescence: TFIIB Antibody [NBP3-35718] - Immunofluorescence analysis of L929 cells using TFIIB Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
TFIIB Antibody

Immunohistochemistry: TFIIB Antibody [NBP3-35718] -

Immunohistochemistry: TFIIB Antibody [NBP3-35718] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using TFIIB Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TFIIB Antibody

Immunohistochemistry: TFIIB Antibody [NBP3-35718] -

Immunohistochemistry: TFIIB Antibody [NBP3-35718] - Immunohistochemistry analysis of paraffin-embedded Human colon using TFIIB Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TFIIB Antibody

Immunohistochemistry: TFIIB Antibody [NBP3-35718] -

Immunohistochemistry: TFIIB Antibody [NBP3-35718] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using TFIIB Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TFIIB Antibody

Immunohistochemistry: TFIIB Antibody [NBP3-35718] -

Immunohistochemistry: TFIIB Antibody [NBP3-35718] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using TFIIB Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
TFIIB Antibody

Western Blot: TFIIB Antibody [NBP3-35718] -

Western Blot: TFIIB Antibody [NBP3-35718] - Western blot analysis of various lysates using TFIIB Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.

Applications for TFIIB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TFIIB

TFIIB encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors IID and IIA. Transcription factor IIB serves as a bridge between IID, the factor which initially recognizes the promoter sequence, and RNA polymerase II. [provided by RefSeq]

Alternate Names

general transcription factor IIB, General transcription factor TFIIB, S300-II, TFIIBTF2BRNA polymerase II transcription factor IIB, transcription initiation factor IIB

Gene Symbol

GTF2B

Additional TFIIB Products

Product Documents for TFIIB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TFIIB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TFIIB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TFIIB Antibody - BSA Free and earn rewards!

Have you used TFIIB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...