THEM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92498

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all THEM2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for THEM2 Antibody - BSA Free

Western Blot: THEM2 Antibody [NBP1-92498]

Western Blot: THEM2 Antibody [NBP1-92498]

Western Blot: THEM2 Antibody [NBP1-92498] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: THEM2 Antibody [NBP1-92498]

Immunocytochemistry/ Immunofluorescence: THEM2 Antibody [NBP1-92498]

Immunocytochemistry/Immunofluorescence: THEM2 Antibody [NBP1-92498] - Immunofluorescent staining of human cell line A-431 shows localization to cell junctions.
Immunohistochemistry-Paraffin: THEM2 Antibody [NBP1-92498]

Immunohistochemistry-Paraffin: THEM2 Antibody [NBP1-92498]

Immunohistochemistry-Paraffin: THEM2 Antibody [NBP1-92498] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: THEM2 Antibody [NBP1-92498]

Western Blot: THEM2 Antibody [NBP1-92498]

Western Blot: THEM2 Antibody [NBP1-92498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
THEM2 Antibody - BSA Free Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
THEM2 Antibody - BSA Free Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
THEM2 Antibody - BSA Free Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Analysis in human kidney and skeletal muscle tissues using NBP1-92498 antibody. Corresponding ACOT13 RNA-seq data are presented for the same tissues.
THEM2 Antibody - BSA Free Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
THEM2 Antibody - BSA Free Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Immunohistochemistry: THEM2 Antibody - BSA Free [NBP1-92498]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
THEM2 Antibody - BSA Free Western Blot: THEM2 Antibody - BSA Free [NBP1-92498]

Western Blot: THEM2 Antibody - BSA Free [NBP1-92498]

Analysis in human cell line HDLM-2.

Applications for THEM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: THEM2

THEM2 encodes a member of the thioesterase superfamily. In humans, the protein co-localizes with microtubules and is essential for sustained cell proliferation. The orthologous mouse protein forms a homotetramer and is associated with mitochondria. The mouse protein functions as a medium- and long-chain acyl-CoA thioesterase. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

acyl-CoA thioesterase 13PNAS-27, EC 3.1.2.-, HT012, hypothalamus protein HT012, MGC4961, THEM2, Thioesterase superfamily member 2acyl-coenzyme A thioesterase 13

Gene Symbol

ACOT13

Additional THEM2 Products

Product Documents for THEM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for THEM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for THEM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review THEM2 Antibody - BSA Free and earn rewards!

Have you used THEM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies