Tight Junction Protein 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85047

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation, Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse, Rat

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tight Junction Protein 1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED

Marker

Intercellular Junctions/Tight Junction Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tight Junction Protein 1 Antibody - BSA Free

Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.
Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047]

Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047]

Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.
Immunohistochemistry: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry: Tight Junction Protein 1 Antibody [NBP1-85047]

Tight-Junction-Protein-1-Antibody-Immunohistochemistry-NBP1-85047-img0025.jpg
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047]

Tight-Junction-Protein-1-Antibody-Western-Blot-NBP1-85047-img0026.jpg
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in control (vector only transfected HEK293T lysate) and TJP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047]

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - The primary mouse lung endothelial cells were fixed, permeabilized and stained with 1:100 diluted anti-ZO-1 ab for overnight. Samples were washed and subsequently incubated with 1:500 diluted Alexa Fuor 546 at room temperature for 1 hour. ICC/iF image submitted by a verified customer reveiw.
Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Monolayer of Human ARPE-19 cells on a glass substrate. Tight Junction Protein 1 staining in red. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047]

Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.
Tight Junction Protein 1 Antibody

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] -

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot analysis of function protein expression on primary human renal cortical epithelial cells challenged with cytokines. Primary human renal tubular epithelial cells are challenged with cytokine cocktail (15nM IFN gamma, 6nM TNF alpha, & 3nM IL1 beta ). (A, B) Expression of Snail, E-Cad, TJP1, SMA. AhR, IDO, KMO, KY, MHCI & II. (C, D) Densitometric quantitation of protein in (A, B). All Western blots are representative of at least three independent experiments. *P < 0.05, ***P < 0.0001 versus to cells without treatment, analysis is multiple t-tests, pairwise comparison of individual time-point to control indicated same p-value. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Tight Junction Protein 1 Antibody

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] -

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The relative expression of ZO-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. b The relative expression of occludin in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. c The relative expression of claudin-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. Values are means (3 pigs per treatment) with standard errors represented by vertical bars. *P < 0.05, **P < 0.01 Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32391146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Tight Junction Protein 1 Antibody

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] -

Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Differentiation of FH- & corr-FH-iPSCs into hepatocytes. a Representative pictures of cell morphology & immunostainings of the indicated markers at day 25 of differentiation. Scale bars: 50 μm. b Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. All images were taken with × 10 objective, z-stacks of xy sections of the cells were acquired with an epifluorescence microscope (Nikon Elipse) & analyzed with ImageJ software. Arrowheads indicate bile canaliculi Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31358055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Tight Junction Protein 1 Antibody

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] -

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma, 6 nM TNF alpha, & 3 nM IL1 beta ) for 24 h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Tight Junction Protein 1 Antibody

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] -

Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma, 6 nM TNF alpha, & 3 nM IL1 beta ) for 24 h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Tight Junction Protein 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 5 reviews rated 4.6 using NBP1-85047 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tight Junction Protein 1

Members of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-1, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-1 is a peripheral membrane protein bound on the cytoplasmic surface of junctional contacts and is expressed in all tight junctions regardless of their properties. ZO-1 immunoprecipitates with its family member ZO-2. ZO-1 was shown to undergo tyrosine phosphorylation during tight junction formation and remodeling. Two different isoforms of ZO-1, alpha-minus and alpha-plus, have been described, which result from alternative splicing of an mRNA encoded by a single gene. The ZO-1 alpha-plus contains an 80 amino acids motif called alpha which is not present in ZO-1 alpha-minus. The alpha-containing isoform is found in most epithelial cell junctions. The short isoform (ZO-1 alpha-minus) is found both in endothelial cells and the highly specialized epithelial junctions of renal glomeruli and Sertoli cells of the seminiferous tubules. This difference in distribution provides molecular distinction among tight junctions.

Alternate Names

DKFZp686M05161, MGC133289, Tight junction protein 1, tight junction protein 1 (zona occludens 1), tight junction protein ZO-1, TJP1, ZO1, ZO-1, zona occludens 1, Zona occludens protein 1, zonula occludens 1 protein, Zonula occludens protein 1

Gene Symbol

TJP1

Additional Tight Junction Protein 1 Products

Product Documents for Tight Junction Protein 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tight Junction Protein 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Tight Junction Protein 1 Antibody - BSA Free

Customer Reviews for Tight Junction Protein 1 Antibody - BSA Free (5)

4.6 out of 5
5 Customer Ratings
5 Stars
60%
4 Stars
40%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Tight Junction Protein 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 5 of 5 reviews Showing All
Filter By:
Clear Filters X
  • Tight Junction Protein 1 Antibody
    Name: James Xiao
    Application: Immunocytochemistry
    Sample Tested: Epithelial cells
    Species: Rat
    Verified Customer | Posted 12/10/2020
    Rat epithelial cells stained positively with Tight Junction Protein 1. Primary ab concentration = 1:100; Secondary ab: goat anti-rabbit- Alexa 488 conjugated = 1: 500
    Tight Junction Protein 1 Antibody - BSA Free NBP1-85047
  • Tight Junction Protein 1 Antibody
    Name: Fabio Marongiu
    Application: Immunocytochemistry
    Sample Tested: ARPE-19 cells
    Species: Human
    Verified Customer | Posted 08/29/2017
    ARPE-19 monolayer on glass substrate
    Fixative 4% PFA Blocking Goat Serum Dilution 1:200 Incubation 1h @ RT
    Tight Junction Protein 1 Antibody - BSA Free NBP1-85047
  • Tight Junction Protein 1 Antibody
    Name: James Xiao
    Application: Western Blot
    Sample Tested: Primary Mouse Lung cells
    Species: Mouse
    Verified Customer | Posted 06/22/2017
    Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA
    Tight Junction Protein 1 Antibody - BSA Free NBP1-85047
  • Tight Junction Protein 1 Antibody
    Name: James Xiao
    Application: ICC/IF
    Sample Tested: Primary mouse lung endotelial cells
    Species: Mouse
    Verified Customer | Posted 10/13/2016
    The primary mouse lung endothelial cells were fixed, permeabilized and stained with 1:100 diluted anti-ZO-1 ab for overnight. Samples were washed and subsequently incubated with 1:500 diluted Alexa Fuor 546 at room temperature for 1 hour.
    Tight Junction Protein 1 Antibody - BSA Free NBP1-85047
  • Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: Pig trabecular meshwork cells
    Species: Other
    Verified Customer | Posted 02/02/2016
    Detection of TJP1 in Pig trabecular meshwork cells
    Tight Junction Protein 1 Antibody - BSA Free NBP1-85047

There are no reviews that match your criteria.

Showing  1 - 5 of 5 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies