TIMM8B Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-94190

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all TIMM8B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of human TIMM8B (NP_036591.1). MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TIMM8B Antibody - Azide and BSA Free

Western Blot: TIMM8B AntibodyAzide and BSA Free [NBP2-94190]

Western Blot: TIMM8B AntibodyAzide and BSA Free [NBP2-94190]

Western Blot: TIMM8B Antibody [NBP2-94190] - Analysis of extracts of various cell lines, using TIMM8B at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunohistochemistry-Paraffin: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Rat brain using TIMM8B antibody at dilution of 1:100 (40x lens).
Immunocytochemistry/ Immunofluorescence: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunocytochemistry/ Immunofluorescence: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunocytochemistry/Immunofluorescence: TIMM8B Antibody [NBP2-94190] - L929 cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunohistochemistry-Paraffin: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Paraffin-embedded human breast cancer using TIMM8B.
Immunohistochemistry-Paraffin: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunohistochemistry-Paraffin: TIMM8B Antibody - Azide and BSA Free [NBP2-94190]

Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Mouse heart using TIMM8B antibody at dilution of 1:100 (40x lens).
TIMM8B Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TIMM8B Antibody - Azide and BSA Free [TIMM8B] -

Immunocytochemistry/ Immunofluorescence: TIMM8B Antibody - Azide and BSA Free [TIMM8B] - Immunofluorescence analysis of U-2 OS cells using TIMM8B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for TIMM8B Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:100

Immunohistochemistry

1:50-1:100

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TIMM8B

TIMM8B belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM]

Alternate Names

DDP2DDP-like protein, DDPL, Deafness dystonia protein 2, FLJ21744, MGC102866, MGC117373, mitochondrial import inner membrane translocase subunit Tim8 B, TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B, translocase of inner mitochondrial membrane 8 homolog B (yeast)

Gene Symbol

TIMM8B

Additional TIMM8B Products

Product Documents for TIMM8B Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TIMM8B Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for TIMM8B Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TIMM8B Antibody - Azide and BSA Free and earn rewards!

Have you used TIMM8B Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies