Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58170

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tissue alpha-L-Fucosidase/FUCA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170] - Analysis in human liver and skeletal muscle tissues using NBP2-58170 antibody. Corresponding FUCA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170] - Staining of human colon, liver, lymph node and skeletal muscle using Anti-FUCA1 antibody NBP2-58170 (A) shows similar protein distribution across tissues to independent antibody NBP2-32044 (B).
Western Blot: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Western Blot: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Western Blot: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170] - Staining of human skeltal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170] - Staining of human lymph node shows strong granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170]

Immunohistochemistry-Paraffin: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-58170] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Applications for Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tissue alpha-L-Fucosidase/FUCA1

Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids (Occhiodoro et al., 1989 [PubMed 2803312]). At least 2 separate polymorphic alpha-L-fucosidases are recognized in man: that in tissues, FUCA1, which is deficient in fucosidosis (MIM 230000), and that in plasma, FUCA2 (MIM 136820).[supplied by OMIM]

Alternate Names

FUCA1, Tissue alphaLFucosidase

Gene Symbol

FUCA1

Additional Tissue alpha-L-Fucosidase/FUCA1 Products

Product Documents for Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free and earn rewards!

Have you used Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies