TOM70 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87863
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse
Cited:
Human
Predicted:
Rat (92%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TOM70 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: TOM70 Antibody [NBP1-87863]
Immunocytochemistry/Immunofluorescence: TOM70 Antibody [NBP1-87863] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863]
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Pancreas shows very weak granular cytoplasmic positivity in exocrine glandular cells.Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863]
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Cerebellum shows strong granular cytoplasmic positivity in Purkinje cells.Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863]
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal cells.Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863]
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human Testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.Simple Western: TOM70 Antibody [NBP1-87863]
Simple Western: TOM70 Antibody [NBP1-87863] - Detection of TOM70 in purified mitochondrial (lanes 1-3 at 1:100, 1:50 and 1:25 dilutions, respectively) and cytosol (lane 4 at 1:25 dilution) preparations of SVG-A cells. Image from verified customer review.Western Blot: TOM70 Antibody - BSA Free [NBP1-87863]
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Western Blot: TOM70 Antibody - BSA Free [NBP1-87863]
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Applications for TOM70 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Simple Western
Verified by a customer review
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
See Simple Western Antibody Database for Simple Western validation: Tested in Purified mitochondrial and cytosol preparations of SVG-A cells, separated by Size, antibody dilution of 1:100
See Simple Western Antibody Database for Simple Western validation: Tested in Purified mitochondrial and cytosol preparations of SVG-A cells, separated by Size, antibody dilution of 1:100
Reviewed Applications
Read 1 review rated 4 using NBP1-87863 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TOM70
Alternate Names
FLJ90470, KIAA0719, mitochondrial import receptor subunit TOM70, Mitochondrial precursor proteins import receptor, TOM70, Translocase of outer membrane 70 kDa subunit, translocase of outer mitochondrial membrane 70 (yeast) homolog A, translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae), translocase of outer mitochondrial membrane 70 homolog A (yeast)
Gene Symbol
TOMM70
Additional TOM70 Products
Product Documents for TOM70 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TOM70 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for TOM70 Antibody - BSA Free
Customer Reviews for TOM70 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used TOM70 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Simple WesternSample Tested: purified mitochondrial and cytosol preparations of SVG-A cellsSpecies: HumanVerified Customer | Posted 08/03/2016Detection of TOM70 in purified mitochondrial (lanes 1-3) and cytosol (lane 4) preparations of SVG-A cells
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...