TOMM20 Antibody (10G6I8)
Novus Biologicals | Catalog # NBP3-15750
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 10G6I8 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOMM20 (NP_055580.1). YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for TOMM20 Antibody (10G6I8)
Western Blot: TOMM20 Antibody (10G6I8) [NBP3-15750]
Western Blot: TOMM20 Antibody (6E0N2) [NBP3-15750] - Western blot analysis of extracts of various cell lines, using TOMM20 antibody (NBP3-15750) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunoprecipitation: TOMM20 Antibody (10G6I8) [NBP3-15750]
Immunoprecipitation: TOMM20 Antibody (6E0N2) [NBP3-15750] - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug TOMM20 antibody (NBP3-15750). Western blot was performed from the immunoprecipitate using TOMM20 antibody (NBP3-15750) at a dilition of 1:1000.Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] -
Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] -
Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -
Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of lysates from HeLa cells using TOMM20 Rabbit mAb at 1:10000-1:640000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of paraffin-embedded Human squamous cell lung carcinoma tissue using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of paraffin-embedded Mouse kidney using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -
Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of various lysates using TOMM20 Rabbit mAb at 1:5000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of HeLa cells using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -
Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - The STORM super-resolution (SR) imaging of COS7 cells using TOMM20 Rabbit mAb at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. in SR image processing and kindly providing this image.Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -
Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of various lysates using TOMM20 Rabbit mAb at 1:20000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -
Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of lysates from 293T cells using TOMM20 Rabbit mAb at 1:5000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] -
Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Rat intestine tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Applications for TOMM20 Antibody (10G6I8)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:100 - 1:500
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Immunoprecipitation
-0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Western Blot
1:2000 - 1:6000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: TOMM20
Long Name
TOMM20
Alternate Names
MAS20, mitochondrial 20 kDa outer membrane protein, mitochondrial import receptor subunit TOM20 homolo, MOM19, outer mitochondrial membrane receptor Tom20, TOM20, translocase of outer mitochondrial membrane 20 hom
Gene Symbol
TOMM20
Additional TOMM20 Products
Product Documents for TOMM20 Antibody (10G6I8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TOMM20 Antibody (10G6I8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for TOMM20 Antibody (10G6I8)
There are currently no reviews for this product. Be the first to review TOMM20 Antibody (10G6I8) and earn rewards!
Have you used TOMM20 Antibody (10G6I8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...