TOMM20 Antibody (10G6I8)

Novus Biologicals | Catalog # NBP3-15750

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10G6I8 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOMM20 (NP_055580.1). YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for TOMM20 Antibody (10G6I8)

Western Blot: TOMM20 Antibody (10G6I8) [NBP3-15750]

Western Blot: TOMM20 Antibody (10G6I8) [NBP3-15750]

Western Blot: TOMM20 Antibody (6E0N2) [NBP3-15750] - Western blot analysis of extracts of various cell lines, using TOMM20 antibody (NBP3-15750) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunoprecipitation: TOMM20 Antibody (10G6I8) [NBP3-15750]

Immunoprecipitation: TOMM20 Antibody (10G6I8) [NBP3-15750]

Immunoprecipitation: TOMM20 Antibody (6E0N2) [NBP3-15750] - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug TOMM20 antibody (NBP3-15750). Western blot was performed from the immunoprecipitate using TOMM20 antibody (NBP3-15750) at a dilition of 1:1000.
TOMM20 Antibody (10G6I8)

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] -

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
TOMM20 Antibody (10G6I8)

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] -

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
TOMM20 Antibody (10G6I8)

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of lysates from HeLa cells using TOMM20 Rabbit mAb at 1:10000-1:640000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
TOMM20 Antibody (10G6I8)

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of paraffin-embedded Human squamous cell lung carcinoma tissue using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
TOMM20 Antibody (10G6I8)

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of paraffin-embedded Mouse kidney using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
TOMM20 Antibody (10G6I8)

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of various lysates using TOMM20 Rabbit mAb at 1:5000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
TOMM20 Antibody (10G6I8)

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of HeLa cells using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
TOMM20 Antibody (10G6I8)

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] -

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - The STORM super-resolution (SR) imaging of COS7 cells using TOMM20 Rabbit mAb at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. in SR image processing and kindly providing this image.
TOMM20 Antibody (10G6I8)

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of various lysates using TOMM20 Rabbit mAb at 1:20000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
TOMM20 Antibody (10G6I8)

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] -

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of lysates from 293T cells using TOMM20 Rabbit mAb at 1:5000 dilution incubated overnight at 4C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
TOMM20 Antibody (10G6I8)

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] -

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Rat intestine tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for TOMM20 Antibody (10G6I8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100 - 1:500

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Immunoprecipitation

-0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:2000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: TOMM20

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Long Name

TOMM20

Alternate Names

MAS20, mitochondrial 20 kDa outer membrane protein, mitochondrial import receptor subunit TOM20 homolo, MOM19, outer mitochondrial membrane receptor Tom20, TOM20, translocase of outer mitochondrial membrane 20 hom

Gene Symbol

TOMM20

Additional TOMM20 Products

Product Documents for TOMM20 Antibody (10G6I8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TOMM20 Antibody (10G6I8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TOMM20 Antibody (10G6I8)

There are currently no reviews for this product. Be the first to review TOMM20 Antibody (10G6I8) and earn rewards!

Have you used TOMM20 Antibody (10G6I8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...