TOMM22 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80671

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all TOMM22 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK

Reactivity Notes

Mouse reactivity reported in (PMID: 30386187). Rat (89%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TOMM22 Antibody - BSA Free

Western Blot: TOMM22 Antibody [NBP1-80671]

Western Blot: TOMM22 Antibody [NBP1-80671]

Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western Blot: TOMM22 Antibody [NBP1-80671]

Western Blot: TOMM22 Antibody [NBP1-80671]

TOMM22-Antibody-Western-Blot-NBP1-80671-img0019.jpg
Immunocytochemistry/ Immunofluorescence: TOMM22 Antibody [NBP1-80671]

Immunocytochemistry/ Immunofluorescence: TOMM22 Antibody [NBP1-80671]

Immunocytochemistry/Immunofluorescence: TOMM22 Antibody [NBP1-80671] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining shown in green.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells..
Western Blot: TOMM22 Antibody [NBP1-80671]

Western Blot: TOMM22 Antibody [NBP1-80671]

Western Blot: TOMM22 Antibody [NBP1-80671] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671]

Immunohistochemistry-Paraffin: TOMM22 Antibody [NBP1-80671] - Staining of human pancreas shows moderate granular cytoplasmic positivity.
TOMM22 Antibody

Western Blot: TOMM22 Antibody [NBP1-80671] -

Western Blot: TOMM22 Antibody [NBP1-80671] - Comparative immunoblot analysis of normal wild type versus mdx-4cv liver extracts. Shown is a representative silver-stained SDS-PAGE gel & corresponding immunoblots with expanded views of labelling with antibodies to the fatty acid binding protein isoforms FABP1 & FABP5, as well as ferritin light chain, carbonic anhydrase isoform CA3, the voltage-dependent anion channel VDAC-1, the mitochondrial outer membrane protein translocation pore subunit TOM22, fibronectin & asporin. Lanes 1 & 2 represent total extracts from control wild type (wt) liver & mdx-4cv liver, respectively. Molecular mass standards (in kDa) are indicated at the left of the gel image. Graphical representations of the immuno-decoration levels of FABP1 & FABP5 are shown (Y-axis: % control): Student’s t test, unpaired; n = 4; *p < 0.05 Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30386187), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TOMM22 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TOMM22

TOMM22 is encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.

Alternate Names

1C9-2, hTom22, mitochondrial import receptor subunit TOM22 homolog, mitochondrial import receptor Tom22, MST065, TOM22MSTP065, Translocase of outer membrane 22 kDa subunit homolog, translocase of outer mitochondrial membrane 22 homolog (yeast)

Entrez Gene IDs

56993 (Human)

Gene Symbol

TOMM22

UniProt

Q9NS69 (Human)

Additional TOMM22 Products

Product Documents for TOMM22 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for TOMM22 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TOMM22 Antibody - BSA Free

Customer Reviews for TOMM22 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TOMM22 Antibody - BSA Free and earn rewards!

Have you used TOMM22 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TOMM22 Antibody - BSA Free

Showing  1 - 3 of 3 FAQs Showing All

  • Q: Could you tell me the molecular weight of the heavy chain please ?

    A: Most IgG molecules have a molecular weight of approximately 150-160kDa. Heavy chains are usually about 50kDa, and light chains approximately 25kDa.

  • Q: Is the antibody TOMM22 NBP1-80671 an IgG ?

    A: Our TOMM22 antibody, NBP1-80671, is a rabbit polyclonal and of the isotype IgG.

  • Q: What is the concentration for the lot A57950 of this antibody?

    A: Lot number A57950 is at a concentration of 0.3mg/ml.

  • Q: Could you tell me the molecular weight of the heavy chain please ?

    A: Most IgG molecules have a molecular weight of approximately 150-160kDa. Heavy chains are usually about 50kDa, and light chains approximately 25kDa.

  • Q: Is the antibody TOMM22 NBP1-80671 an IgG ?

    A: Our TOMM22 antibody, NBP1-80671, is a rabbit polyclonal and of the isotype IgG.

  • Q: What is the concentration for the lot A57950 of this antibody?

    A: Lot number A57950 is at a concentration of 0.3mg/ml.

  • Q: Could you tell me the molecular weight of the heavy chain please ?

    A: Most IgG molecules have a molecular weight of approximately 150-160kDa. Heavy chains are usually about 50kDa, and light chains approximately 25kDa.

  • Q: Is the antibody TOMM22 NBP1-80671 an IgG ?

    A: Our TOMM22 antibody, NBP1-80671, is a rabbit polyclonal and of the isotype IgG.

  • Q: What is the concentration for the lot A57950 of this antibody?

    A: Lot number A57950 is at a concentration of 0.3mg/ml.

Showing  1 - 3 of 3 FAQs Showing All
View all FAQs for Antibodies