Topoisomerase I Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90365

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Topoisomerase I Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Topoisomerase I Antibody - BSA Free

Topoisomerase I Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Topoisomerase I Antibody - BSA Free [NBP1-90365]

Immunocytochemistry/ Immunofluorescence: Topoisomerase I Antibody - BSA Free [NBP1-90365]

Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Analysis in human placenta and skeletal muscle tissues. Corresponding TOP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human placenta shows very strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365]

Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human lymphoid tissues shows strong nuclear positivity in germinal center cells.
Topoisomerase I Antibody - BSA Free Western Blot: Topoisomerase I Antibody - BSA Free [NBP1-90365]

Western Blot: Topoisomerase I Antibody - BSA Free [NBP1-90365]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Topoisomerase I Antibody - BSA Free Western Blot: Topoisomerase I Antibody - BSA Free [NBP1-90365]

Western Blot: Topoisomerase I Antibody - BSA Free [NBP1-90365]

Analysis in human cell line HEL.

Applications for Topoisomerase I Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Topoisomerase I

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Long Name

DNA topoisomerase 1

Alternate Names

DNA topoisomerase I, EC 5.6.2.1, TOP1

Gene Symbol

TOP1

Additional Topoisomerase I Products

Product Documents for Topoisomerase I Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Topoisomerase I Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Topoisomerase I Antibody - BSA Free

Customer Reviews for Topoisomerase I Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Topoisomerase I Antibody - BSA Free and earn rewards!

Have you used Topoisomerase I Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies