TORC1 Antibody (8F9) - Azide and BSA Free

Novus Biologicals | Catalog # H00023373-M01

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 8F9

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CRTC1 (NP_056136.1, 553 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL

Specificity

This product is specific for Human CRTC1 monoclonal antibody (M01), clone 8F9 [Gene ID: 23373].

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for TORC1 Antibody (8F9) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: TORC1 Antibody (8F9) [H00023373-M01]

Immunocytochemistry/ Immunofluorescence: TORC1 Antibody (8F9) [H00023373-M01]

Immunocytochemistry/Immunofluorescence: TORC1 Antibody (8F9) [H00023373-M01] - Analysis of monoclonal antibody to CRTC1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: TORC1 Antibody (8F9) [H00023373-M01] - Detection limit for recombinant GST tagged CRTC1 is 0.1 ng/ml as a capture antibody.

Applications for TORC1 Antibody (8F9) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Mouse monoclonal antibody raised against a partial recombinant CRTC1.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TORC1

MECT1 (also known as MucoEpidermoid Carcinoma Translocated 1, Transducer of regulated cAMP response element-binding protein 1, TORC1, and Transducer of CREB protein 1) is a nuclear protein that functions as a transcriptional coactivator for CREB1, which activates transcription through both consensus and variant cAMP response element (CRE) sites. MECT1does not appear to modulate CREB1 DNA-binding activity but enhances the interaction of CREB1 with TAF4/TAFII-130. MECT1 translocates with MAML2 (MasterMind-Like Protein 2) to yield a fusion oncogene: t(11;19) (q21;p13). This translocation occurs in mucoepidermoid carcinomas, benign Warthin tumors and clear cell hidradenomas. The novel fusion product that results disrupts the Notch signaling pathway. The fusion protein consists of the N-terminus of MECT1 joined to the C-terminus of MAML2. The reciprocal fusion protein consisting of the N-terminus of MAML2 joined to the C-terminus of MECT1 has been detected in a small number of mucoepidermoid carcinomas. Multiple isoforms have been reported for the MECT1 protein.

Long Name

Transducer of Regulated CREB protein 1

Alternate Names

CRTC1, MECT1, WAMTP1

Gene Symbol

CRTC1

Additional TORC1 Products

Product Documents for TORC1 Antibody (8F9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TORC1 Antibody (8F9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for TORC1 Antibody (8F9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review TORC1 Antibody (8F9) - Azide and BSA Free and earn rewards!

Have you used TORC1 Antibody (8F9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...