Transglutaminase 1/TGM1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34062

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGRSFWARCCGCCSCRNAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Transglutaminase 1/TGM1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human esophagus and liver tissues using NBP2-34062 antibody. Corresponding TGM1 RNA-seq data are presented for the same tissues.
Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Western Blot: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human colon shows no positivity in glandular cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human skin shows moderate membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062]

Immunohistochemistry-Paraffin: Transglutaminase 1/TGM1 Antibody [NBP2-34062] - Staining of human tonsil shows moderate membranous positivity in sqamous epithelial cells.
Transglutaminase 1/TGM1 Antibody - BSA Free

Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -

ATF4 and CHOP are required for efficient TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against ATF4 (A and C) or CHOP (B and D) as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A and B) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on lytic EBV proteins BZLF1, BRLF1, BMRF1 and p18 VCA as indicated. (C and D) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on TPA-induced differentiation markers BLIMP1, TGM1, and SPRR1A as indicated. Tubulin served as a loading control. The cellular extracts used in (A) and (C) or (B) and (D) were the same. The same ATF4 and Tubulin blots were used in (A) and (C), and the same CHOP and Tubulin blots were used for (B) and (D). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Transglutaminase 1/TGM1 Antibody - BSA Free

Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -

GCN2 is required for TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against GCN2 as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A) Immunoblot analysis was performed to examine the effect of GCN2 knock-down on proteins involved in the ISR pathway (including p-GCN2, GCN2, p-eIF2 alpha, eiF2 alpha, ATF4, and CHOP) and EBV lytic proteins (BZLF1, BRLF1, BMRF1, and p18 VCA). (B) Immunoblot analyses were performed to examine the effect of GCN2 knock-down on differentiation-induced cellular proteins Involucrin, BLIMP1, and TGM1. Tubulin served as a loading control for both panels. The same extracts were used for each panel, and the same GCN2, p-GCN2, and Tubulin blots were used for both panels. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Transglutaminase 1/TGM1 Antibody - BSA Free

Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -

PERK is also required for efficient TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against PERK as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A) Immunoblot analyses were performed to examine the effect of PERK knock-down on EBV lytic proteins BZLF1, BRLF1, and BMRF1. (B) Immunoblot analyses were performed to examine the effect of PERK knock-down on differentiation-induced cellular proteins BLIMP1, TGM1, Involucrin and SPRR1A. Tubulin served as a loading control for both panels. The same extracts were used for both panels, and the same PERK and Tubulin blots were used for both panels. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Transglutaminase 1/TGM1 Antibody - BSA Free

Western Blot: Transglutaminase 1/TGM1 Antibody - BSA Free [NBP2-34062] -

ATF4 and CHOP are required for efficient TPA-induced lytic EBV reactivation and differentiation in WT EBV-infected NOKs.WT EBV-infected NOKs cells were transfected with control siRNA or siRNAs against ATF4 (A and C) or CHOP (B and D) as indicated, and then treated with TPA for 24 hours starting one day after siRNA transfection. (A and B) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on lytic EBV proteins BZLF1, BRLF1, BMRF1 and p18 VCA as indicated. (C and D) Immunoblot analyses were performed to examine the effect of ATF4 and CHOP knock-down on TPA-induced differentiation markers BLIMP1, TGM1, and SPRR1A as indicated. Tubulin served as a loading control. The cellular extracts used in (A) and (C) or (B) and (D) were the same. The same ATF4 and Tubulin blots were used in (A) and (C), and the same CHOP and Tubulin blots were used for (B) and (D). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39951426), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Transglutaminase 1/TGM1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Transglutaminase 1/TGM1

Tissue transglutaminase is a calcium activated enzyme which catalyzes the cross linking of proteins and the conjugation of polyamines to proteins. The identification of transglutaminase as the main antigen of endomysium antibodies allows a new diagnostic approach to celiac disease (CD). CD, a genetic, immunologically mediated small bowel enteropathy that causes malabsorption, is one of the more common disorders in Western countries.

Alternate Names

ICR2, KTG, LI1, TGase-1, TGK, TGM1

Gene Symbol

TGM1

UniProt

Additional Transglutaminase 1/TGM1 Products

Product Documents for Transglutaminase 1/TGM1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Transglutaminase 1/TGM1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Transglutaminase 1/TGM1 Antibody - BSA Free

Customer Reviews for Transglutaminase 1/TGM1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Transglutaminase 1/TGM1 Antibody - BSA Free and earn rewards!

Have you used Transglutaminase 1/TGM1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...