Tropomodulin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87378

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Tropomodulin 2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Tropomodulin 2 Antibody - BSA Free

Western Blot: Tropomodulin 2 Antibody [NBP1-87378]

Western Blot: Tropomodulin 2 Antibody [NBP1-87378]

Western Blot: Tropomodulin 2 Antibody [NBP1-87378] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: Tropomodulin 2 Antibody [NBP1-87378]

Immunocytochemistry/ Immunofluorescence: Tropomodulin 2 Antibody [NBP1-87378]

Immunocytochemistry/Immunofluorescence: Tropomodulin 2 Antibody [NBP1-87378] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoli fibrillar center.
Tropomodulin 2 Antibody - BSA Free Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378]

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378]

Analysis in human cerebral cortex and pancreas tissues.
Tropomodulin 2 Antibody - BSA Free Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378]

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378]

Staining of human pancreas shows low expression as expected.
Tropomodulin 2 Antibody - BSA Free Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378]

Immunohistochemistry-Paraffin: Tropomodulin 2 Antibody [NBP1-87378]

Staining of human cerebral cortex shows high expression.

Applications for Tropomodulin 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tropomodulin 2

Tropomodulin 2 encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq]

Alternate Names

MGC39481, Neuronal tropomodulin, N-Tmod, NTMODtropomodulin-2, tropomodulin 2 (neuronal)

Entrez Gene IDs

29767 (Human)

Gene Symbol

TMOD2

UniProt

Q9NZR1 (Human)

Additional Tropomodulin 2 Products

Product Documents for Tropomodulin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Tropomodulin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Tropomodulin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Tropomodulin 2 Antibody - BSA Free and earn rewards!

Have you used Tropomodulin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies