TSPAN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33867

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: TMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TSPAN1 Antibody - BSA Free

Knockdown Validated: TSPAN1 Antibody [NBP2-33867]

Western Blot: TSPAN1 Antibody [NBP2-33867]

TSPAN1-Antibody-Knockdown-Validated-NBP2-33867-img0018.jpg
Western Blot: TSPAN1 Antibody [NBP2-33867]

Western Blot: TSPAN1 Antibody [NBP2-33867]

Western Blot: TSPAN1 Antibody [NBP2-33867] - Analysis in human cell line PC-3 and human cell line HeLa.
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Analysis in human kidney and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867]

Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867]

Immunocytochemistry/Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Western Blot: TSPAN1 Antibody [NBP2-33867]

Western Blot: TSPAN1 Antibody [NBP2-33867]

TSPAN1-Antibody-Western-Blot-NBP2-33867-img0019.jpg
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human colon shows weak to moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]

Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
TSPAN1 Antibody

Western Blot: TSPAN1 Antibody [NBP2-33867] -

Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TSPAN1 Antibody

Western Blot: TSPAN1 Antibody [NBP2-33867] -

Western Blot: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected with siRNA for TSPAN1 or negative control (NC) in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected with siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells with or without TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by silencing TSPAN1 in A549 cells. C, Quantification of the results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of the results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected after overexpression of TSPAN1 in A549 cells. G, Quantification of the results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of the results in panel (H). J, Phosphorylation of Smad2/3 was detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of the results in panel (J). The data are expressed as the means ± SEM (n = 3), with results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TSPAN1 Antibody

Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867] -

Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected w/ siRNA for TSPAN1 or negative control (NC) in A549 cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected w/ siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by silencing TSPAN1 in A549 cells. C, Quantification of Results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of Results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected after overexpression of TSPAN1 in A549 cells. G, Quantification of Results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of Results in panel (H). J, Phosphorylation of Smad2/3 detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of Results in panel (J). The data are expressed as the means ± SEM (n = 3), w/ results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
TSPAN1 Antibody

Western Blot: TSPAN1 Antibody [NBP2-33867] -

Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for TSPAN1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TSPAN1

Tetraspanin-1 is encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Long Name

Tetraspanin 1

Alternate Names

NET1, TM4C, TM4SF

Gene Symbol

TSPAN1

UniProt

Additional TSPAN1 Products

Product Documents for TSPAN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for TSPAN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for TSPAN1 Antibody - BSA Free

Customer Reviews for TSPAN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review TSPAN1 Antibody - BSA Free and earn rewards!

Have you used TSPAN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...