TSPAN1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33867
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for TSPAN1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867]
Immunocytochemistry/Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.Western Blot: TSPAN1 Antibody [NBP2-33867]
TSPAN1-Antibody-Western-Blot-NBP2-33867-img0019.jpgImmunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human colon shows weak to moderate cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867]
Immunohistochemistry-Paraffin: TSPAN1 Antibody [NBP2-33867] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.Western Blot: TSPAN1 Antibody [NBP2-33867] -
Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: TSPAN1 Antibody [NBP2-33867] -
Western Blot: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected with siRNA for TSPAN1 or negative control (NC) in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected with siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells with or without TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by silencing TSPAN1 in A549 cells. C, Quantification of the results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of the results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected after overexpression of TSPAN1 in A549 cells. G, Quantification of the results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 were detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of the results in panel (H). J, Phosphorylation of Smad2/3 was detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of the results in panel (J). The data are expressed as the means ± SEM (n = 3), with results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867] -
Immunocytochemistry/ Immunofluorescence: TSPAN1 Antibody [NBP2-33867] - Tetraspanin 1 (TSPAN1) modulates beta‐catenin & phosphorylation of Smad2/3. Immunofluorescence staining analysis of TSPAN1 & phosphorylation of Smad2/3 after transfected w/ siRNA for TSPAN1 or negative control (NC) in A549 cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL transforming growth factor‐ beta 1 [TGF‐ beta 1] or control) (green: TSPAN1; red: P‐smad2/3; blue: 4′,6‐diamidino‐2‐phenylindole). Magnification: 1200X. (B‐I) Western blot analysis of various proteins after transfected w/ siRNA or exogenous expression plasmid for TSPAN1 or NC in A549 & alveolar epithelial type II (ATII) cells w/ or w/out TGF‐ beta 1 treatment (5 ng/mL; 0, 12, 24 h). B, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by silencing TSPAN1 in A549 cells. C, Quantification of Results in panel (A). D, The proteins expression of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected, using western blotting after silencing TSPAN1 in ATII cells. E, Quantification of Results in panel (D). F, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected after overexpression of TSPAN1 in A549 cells. G, Quantification of Results in panel (F). H, Proteins of Smad2/3, beta‐catenin & phosphorylation of Smad2/3 detected by Western blotting after overexpression of TSPAN1 in ATII cells. I, Quantification of Results in panel (H). J, Phosphorylation of Smad2/3 detected by Western blotting in intranuclear or cytoplasm after silencing TSPAN1 in A549 cells. K, Quantification of Results in panel (J). The data are expressed as the means ± SEM (n = 3), w/ results representative of 3 independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: TSPAN1 Antibody [NBP2-33867] -
Western Blot: TSPAN1 Antibody [NBP2-33867] - Knockdown tetraspanin 1 (TSPAN1) promoted cell migration & transforming growth factor‐ beta 1 (TGF‐ beta 1)‐induced epithelial‐to‐mesenchymal transition‐related proteins in alveolar epithelial cells. A, Wound healing assay following silencing of TSPAN1 in A549 cells. B, Quantification results of wound healing assay. Bar chart represents the ratio of every group to negative control (NC) groups. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05 vs NC). C, Transwell migration analysis by silencing TSPAN1 in A549 cells with or without TGF‐ beta 1 treatment (5 ng/mL, 16 h). D, Quantification of transwell migration analysis. The bar chart represents the numbers of migrating cells. The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (**P < 0.01 vs NC). (E,G) Western blot analysis of various proteins by silencing TSPAN1 for 24 h in A549 & alveolar epithelial type II cells with or without TGF‐ beta 1 treatment. F, Quantification of the results in panel (E), & (H) quantification of the results in panel (G). The data are expressed as the means ± SEM (n = 3), with results representative of three independent experiments. (*P < 0.05, **P < 0.01, ***P < 0.001 vs NC 0 h; #P < 0.05, ##P < 0.01, ###P < 0.001 vs NC 12 h; delta P < 0.05, delta delta P < 0.01, delta delta delta P < 0.001 vs NC 24 h) Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30869194), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for TSPAN1 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04 - 0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: TSPAN1
Additional TSPAN1 Products
Product Documents for TSPAN1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for TSPAN1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for TSPAN1 Antibody - BSA Free
Customer Reviews for TSPAN1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review TSPAN1 Antibody - BSA Free and earn rewards!
Have you used TSPAN1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...