Tyrosine Hydroxylase Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-38903
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Tyrosine Hydroxylase Antibody - BSA Free (NBP2-38903) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Tyrosine Hydroxylase Antibody - BSA Free
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse midbrain shows positive processes and cell bodies.Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human caudate shows moderate positivity in neuropil.Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human stomach shows no positivity in glandular cells as expected.Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse amygdala shows positive processes.Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse caudate putamen shows synaptic immunoreactivity.Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse hindbrain shows positivity in the locus coeruleus.Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903]
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse hypothalamus shows immunoreactivity in a subset of neurons in the paraventricular nucleus.Applications for Tyrosine Hydroxylase Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Tyrosine Hydroxylase
Two transcription factor binding sites in the proximal region of the TH gene, the TPA-responsive element (TRE) and the c-AMP responsive element (CRE), have been implicated in the complex regulation of the TH gene. Dysregulation of breakdown for the amino acid, tyrosine, by TH is a result of a genetic disorder that results in Tyrosinemia (high levels of tyrosine in the blood, tissue and organs).
Tyrosine hydroxylase deficiency is a disorder that primarily affects movement, where individuals display symptoms that include lack of coordination when walking, postural tremors and unusual body positioning. TH deficient dopamine-responsive dystonia (DRD), also known as Segawa syndrome, is a rare genetic disorder that is associated with low levels of TH and is diagnosed during childhood with characteristic symptoms including increased muscle tone (dystonia) and signs of Parkinsonism like bradykinesia, tremors, rigidity and postural instability (2). Correspondingly, TH is also linked to Parkinson's disease in older adults, where low dopamine levels are a consistent neurochemical abnormality. Functional polymorphisms of the TH gene may be involved in the pathogenesis of neuropsychiatric diseases such as schizophrenia and other affective disorders where dopamine is often dysregulated (3).
References
1. Hamanaka, Y., & Mizunami, M. (2019). Tyrosine hydroxylase-immunoreactive neurons in the mushroom body of the field cricket, Gryllus bimaculatus. Cell Tissue Res, 376(1), 97-111. doi:10.1007/s00441-018-2969-9
2. Li, L., & Zhou, F. M. (2013). Parallel dopamine D1 receptor activity dependence of l-Dopa-induced normal movement and dyskinesia in mice. Neuroscience, 236, 66-76. doi:10.1016/j.neuroscience.2012.12.065
3. Borkar, C. D., Bharne, A. P., Nagalakshmi, B., Sakharkar, A. J., Subhedar, N. K., & Kokare, D. M. (2018). Cocaine- and Amphetamine-Regulated Transcript Peptide (CART) Alleviates MK-801-Induced Schizophrenic Dementia-Like Symptoms. Neuroscience, 375, 94-107. doi:10.1016/j.neuroscience.2018.01.056
Additional Tyrosine Hydroxylase Products
Product Documents for Tyrosine Hydroxylase Antibody - BSA Free
Product Specific Notices for Tyrosine Hydroxylase Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Tyrosine Hydroxylase Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Tyrosine Hydroxylase Antibody - BSA Free and earn rewards!
Have you used Tyrosine Hydroxylase Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...