UAP56 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38530

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human UAP56 (NP_004631.1).

Sequence:
RGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UAP56 Antibody - BSA Free

UAP56 Antibody

Immunocytochemistry/ Immunofluorescence: UAP56 Antibody [NBP3-38530] -

Immunocytochemistry/ Immunofluorescence: UAP56 Antibody [NBP3-38530] - Immunofluorescence analysis of C6 cells using UAP56 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
UAP56 Antibody

Immunohistochemistry: UAP56 Antibody [NBP3-38530] -

Immunohistochemistry: UAP56 Antibody [NBP3-38530] - Immunohistochemistry analysis of paraffin-embedded Rat brain using UAP56 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
UAP56 Antibody

Immunohistochemistry: UAP56 Antibody [NBP3-38530] -

Immunohistochemistry: UAP56 Antibody [NBP3-38530] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer using UAP56 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
UAP56 Antibody

Immunocytochemistry/ Immunofluorescence: UAP56 Antibody [NBP3-38530] -

Immunocytochemistry/ Immunofluorescence: UAP56 Antibody [NBP3-38530] - Immunofluorescence analysis of U-2 OS cells using UAP56 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
UAP56 Antibody

Immunohistochemistry: UAP56 Antibody [NBP3-38530] -

Immunohistochemistry: UAP56 Antibody [NBP3-38530] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using UAP56 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
UAP56 Antibody

Western Blot: UAP56 Antibody [NBP3-38530] -

Western Blot: UAP56 Antibody [NBP3-38530] - Western blot analysis of various lysates using UAP56 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.
UAP56 Antibody

Immunocytochemistry/ Immunofluorescence: UAP56 Antibody [NBP3-38530] -

Immunocytochemistry/ Immunofluorescence: UAP56 Antibody [NBP3-38530] - Immunofluorescence analysis of NIH-3T3 cells using UAP56 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for UAP56 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:100 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UAP56

UAP56 encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and also plays an important role in mRNA export from the nucleus to the cytoplasm. A cluster of genes, BAT1-BAT5, is localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants encoding the same protein have been described.

Alternate Names

56 kDa U2AF65-associated protein, ATP-dependent RNA helicase p47, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B, DEAD box protein UAP56, EC 3.6.4.13, HLA-B associated transcript 1, HLA-B-associated transcript 1 protein, spliceosome RNA helicase BAT1, UAP56D6S81EBAT1nuclear RNA helicase (DEAD family)

Gene Symbol

DDX39B

Additional UAP56 Products

Product Documents for UAP56 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UAP56 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UAP56 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UAP56 Antibody - BSA Free and earn rewards!

Have you used UAP56 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...