UbcH8/Ube2L6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35375

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all UbcH8 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-153 of human UbcH8/Ube2L6 (NP_004214.1).

Sequence:
AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UbcH8/Ube2L6 Antibody - BSA Free

UbcH8/Ube2L6 Antibody

Western Blot: UbcH8/Ube2L6 Antibody [NBP3-35375] -

Western Blot: UbcH8/Ube2L6 Antibody [NBP3-35375] - Western blot analysis of various lysates, using UbcH8/Ube2L6 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
UbcH8/Ube2L6 Antibody

Immunocytochemistry/ Immunofluorescence: UbcH8/Ube2L6 Antibody [NBP3-35375] -

Immunocytochemistry/ Immunofluorescence: UbcH8/Ube2L6 Antibody [NBP3-35375] - Immunofluorescence analysis of HeLa cells using UbcH8/Ube2L6 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
UbcH8/Ube2L6 Antibody

Immunocytochemistry/ Immunofluorescence: UbcH8/Ube2L6 Antibody [NBP3-35375] -

Immunocytochemistry/ Immunofluorescence: UbcH8/Ube2L6 Antibody [NBP3-35375] - Immunofluorescence analysis of NIH/3T3 cells using UbcH8/Ube2L6 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for UbcH8/Ube2L6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UbcH8

Ubiquitin-conjugating enzyme E2L6 (UBE2L6), also known as UbcH8, is a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination of a protein substrate requires the concerted action of 3 classes of enzymes: E1 ubiquitin-activating enzymes, E2 ubiquitin-conjugating enzymes, and E3 ubiquitin protein ligases. The E2 ubiquitin-conjugating enzyme is highly similar in primary structure to the enzyme encoded by UBE2L3 gene.

Alternate Names

RIG-B, UBE2L6

Gene Symbol

UBE2L6

Additional UbcH8 Products

Product Documents for UbcH8/Ube2L6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for UbcH8/Ube2L6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UbcH8/Ube2L6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UbcH8/Ube2L6 Antibody - BSA Free and earn rewards!

Have you used UbcH8/Ube2L6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Ubiquitination Cascade Pathway Ubiquitination Cascade Pathway Thumbnail