UBE2J2/UBC6 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59760
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated
Cited:
Western Blot, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to UBE2J2(ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast)) The peptide sequence was selected from the C terminal of UBE2J2. Peptide sequence GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for UBE2J2/UBC6 Antibody - BSA Free
Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760]
Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760]
Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] -
Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - TMEM129 & Ube2J2 are required for US11-induced FcRn ubiquitination, a, b TMEM129 & Ube2J2 is required for US11-induced FcRn ubiquitination. HeLaFcRn+US11 cells were transfected with 20 nM TMEM129, Ube2J1, or Ube2J2 siRNA oligomers for 48 h or empty vector. Cells were subsequently treated with 50 μM MG132 for 4 h & then lysed. All immunoprecipitates or cell lysates (20 μg) as internal controls were subject to western blotting with corresponding Abs as indicated. c, d HeLaUS11+FcRn cells were transfected with 20 nM Ube2J1 (c, top) & Ube2J2 (c, bottom) siRNA oligomers for 48 h. Cells were then treated with CHX (100 μg/ml) & chased for the indicated time. The cells were lysed after CHX treatment & cell lysates (20 μg) were subject to western blotting with Abs as indicated. The level of remaining FcRn (d) in Ube2j1 siRNA-treated cells (black) or Ube2j2 siRNA-treated cells (red) was quantified as the percentage of the beta -tubulin level at different time points. The percentage of time point 0 (min) is assigned a value of 100% & the values from other time points are normalized to this value. Error bars represented mean ± SEM of three independent repeats Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31289263), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for UBE2J2/UBC6 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Paraffin
1:10-1:500
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: UBE2J2
Long Name
Ubiquitin-conjugating Enzyme E2, J2
Alternate Names
NCUBE2, PRO2121, Ubc6, Ubc6p
Gene Symbol
UBE2J2
Additional UBE2J2 Products
Product Documents for UBE2J2/UBC6 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for UBE2J2/UBC6 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for UBE2J2/UBC6 Antibody - BSA Free
Customer Reviews for UBE2J2/UBC6 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review UBE2J2/UBC6 Antibody - BSA Free and earn rewards!
Have you used UBE2J2/UBC6 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...