UBE2J2/UBC6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59760

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Cited:

Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to UBE2J2(ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast)) The peptide sequence was selected from the C terminal of UBE2J2. Peptide sequence GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for UBE2J2/UBC6 Antibody - BSA Free

Knockdown Validated: UBE2J2/UBC6 Antibody [NBP1-59760]

Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760]

UBE2J2-UBC6-Antibody-Knockdown-Validated-NBP1-59760-img0004.jpg
Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760]

Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760]

Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760]

Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760]

Immunohistochemistry-Paraffin: UBE2J2/UBC6 Antibody [NBP1-59760] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
UBE2J2/UBC6 Antibody

Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] -

Western Blot: UBE2J2/UBC6 Antibody [NBP1-59760] - TMEM129 & Ube2J2 are required for US11-induced FcRn ubiquitination, a, b TMEM129 & Ube2J2 is required for US11-induced FcRn ubiquitination. HeLaFcRn+US11 cells were transfected with 20 nM TMEM129, Ube2J1, or Ube2J2 siRNA oligomers for 48 h or empty vector. Cells were subsequently treated with 50 μM MG132 for 4 h & then lysed. All immunoprecipitates or cell lysates (20 μg) as internal controls were subject to western blotting with corresponding Abs as indicated. c, d HeLaUS11+FcRn cells were transfected with 20 nM Ube2J1 (c, top) & Ube2J2 (c, bottom) siRNA oligomers for 48 h. Cells were then treated with CHX (100 μg/ml) & chased for the indicated time. The cells were lysed after CHX treatment & cell lysates (20 μg) were subject to western blotting with Abs as indicated. The level of remaining FcRn (d) in Ube2j1 siRNA-treated cells (black) or Ube2j2 siRNA-treated cells (red) was quantified as the percentage of the beta -tubulin level at different time points. The percentage of time point 0 (min) is assigned a value of 100% & the values from other time points are normalized to this value. Error bars represented mean ± SEM of three independent repeats Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31289263), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for UBE2J2/UBC6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: UBE2J2

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J2 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Long Name

Ubiquitin-conjugating Enzyme E2, J2

Alternate Names

NCUBE2, PRO2121, Ubc6, Ubc6p

Gene Symbol

UBE2J2

Additional UBE2J2 Products

Product Documents for UBE2J2/UBC6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE2J2/UBC6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for UBE2J2/UBC6 Antibody - BSA Free

Customer Reviews for UBE2J2/UBC6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2J2/UBC6 Antibody - BSA Free and earn rewards!

Have you used UBE2J2/UBC6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail