UBE2R1/CDC34 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38156

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human UBE2R1/CDC34 (NP_004350.1).

Sequence:
KWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for UBE2R1/CDC34 Antibody - BSA Free

UBE2R1/CDC34 Antibody

Immunocytochemistry/ Immunofluorescence: UBE2R1/CDC34 Antibody [NBP3-38156] -

Immunocytochemistry/ Immunofluorescence: UBE2R1/CDC34 Antibody [NBP3-38156] - Immunofluorescence analysis of BALB-3T3 cells using UBE2R1/CDC34 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
UBE2R1/CDC34 Antibody

Western Blot: UBE2R1/CDC34 Antibody [NBP3-38156] -

Western Blot: UBE2R1/CDC34 Antibody [NBP3-38156] - Western blot analysis of various lysates using UBE2R1/CDC34 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
UBE2R1/CDC34 Antibody

Western Blot: UBE2R1/CDC34 Antibody [NBP3-38156] -

Western Blot: UBE2R1/CDC34 Antibody [NBP3-38156] - Western blot analysis of lysates from Mouse testis, using UBE2R1/CDC34 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for UBE2R1/CDC34 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: UBE2R1/CDC34

Cdc34 is a ubiquitin conjugating enzyme (UBC) or E2 that has been shown to be essential for the G1 to S phase transition in S. cerevisiae. Human Cdc34 fully complements the budding yeast Cdc34 temperature sensitive mutant phenotype. In egg extracts of the frog Xenopus laevis, Cdc34 has been shown to be required for the onset of DNA replication and appears to function in a multi-protein complex. Also, Cdc34 is highly conserved among vertebrates and is likely to function in a similar manner in all eukaryotes to regulate the start of DNA synthesis.

Alternate Names

Cdc34, UBC3

Gene Symbol

CDC34

Additional UBE2R1/CDC34 Products

Product Documents for UBE2R1/CDC34 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for UBE2R1/CDC34 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for UBE2R1/CDC34 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review UBE2R1/CDC34 Antibody - BSA Free and earn rewards!

Have you used UBE2R1/CDC34 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Ubiquitination Cascade Pathway
Ubiquitination Cascade Pathway Thumbnail