UCH-L1/PGP9.5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87334
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL
Reactivity Notes
Reactivity reported in scientific literature (PMID: 20587347)
Marker
pan-Neuronal Marker
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for UCH-L1/PGP9.5 Antibody - BSA Free
Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cerebral cortex tissue.Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons and in neuropil.Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human liver shows no positivity in hepatocytes, as expected.Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human rectum shows strong cytoplasmic positivity in peripheral ganglion and peripheral nerves.Immunocytochemistry/ Immunofluorescence: UCH-L1/PGP9.5 Antibody [NBP1-87334]
Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.Applications for UCH-L1/PGP9.5 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:2500 - 1:5000
Immunohistochemistry-Paraffin
1:2500 - 1:5000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: UCH-L1/PGP9.5
UCH L1 is down-regulated in brains from Parkinson disease and Alzheimer disease patients, and certian site specific mutations in the UCHL1 gene can either increase or decrese the risk of Parkinson's and/or Alzheimer's neurodegenerative diseases.
Human UCHL 1 and the closely related UCHL3 protein have one of the most complicated knot structures ever discovered, with five knot crossings. This knot structure is expected to help the protein resist degradation in the proteasome.
Long Name
Ubiquitin C-terminal Hydrolase L1
Alternate Names
PARK5, PGP9.5, UCHL1
Gene Symbol
UCHL1
Additional UCH-L1/PGP9.5 Products
Product Documents for UCH-L1/PGP9.5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for UCH-L1/PGP9.5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for UCH-L1/PGP9.5 Antibody - BSA Free
Customer Reviews for UCH-L1/PGP9.5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review UCH-L1/PGP9.5 Antibody - BSA Free and earn rewards!
Have you used UCH-L1/PGP9.5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...